Untersuchungen Zur KurzzeitRegulation Und Adaptation Von Photosynthese Und Elektronenverteilung

Untersuchungen Zur KurzzeitRegulation Und Adaptation Von Photosynthese Und Elektronenverteilung

DESCARGAR PDF

Untersuchungen zur Kurzzeit-Regulation und Adaptation von
Photosynthese und Elektronenverteilung in
Chloroplasten und transgenen Kartoffelpflanzen
Inaugural-Dissertation
zur Erlangung des Doktorgrades
eingereicht an der
Universität Osnabrück
Fachbereich Biologie/Chemie
von
Simone Holtgrefe
aus Ostercappeln
Osnabrück, 2002
1 Einleitung 1
2 Material und Methoden 18
3 Ergebnisse 44
4. Diskussion 103
5 Zusammenfassung 137
6 Literatur 139
7 Anhang 154
1 Einleitung
Pflanzen sind durch ihre Standortgebundenheit ständig wechselnden
äußeren Umwelteinflüssen, wie Licht, Temperatur, Wasser- und
Nährstoffversorgung sowie CO2-Konzentration, ausgesetzt, unter denen
sie wachsen und an die sie sich innerhalb einer gewissen Spannweite
anpassen. Längerfristige Änderungen der Standortfaktoren bewirken eine
Adaptation von Anatomie, Morphologie und Physiologie sowie von
Protein- und Pigmentzusammensetzung der Pflanzen über Auswirkungen auf
genetischer Ebene.
Demgegenüber ist die Pflanze auch in der Lage, kurzfristige, extreme
Schwankungen zu tole­rieren. Oft treten sehr schnell Änderungen in der
eingestrahlten Lichtintensität und in der Temperatur auf, die sich
insbesondere auf den Elektronendruck in den Elektronentransport­ketten
und auf den Redoxstatus im Chloroplastenstroma auswirken. So werden
unter Starklicht mehr Photonen absorbiert, als für eine optimale CO2-Fixierung
notwendig ist, während im Schwachlicht eine Optimierung des
Elektronentransportes und des stromalen Metabolismus an die reduzierte
Elektronenverfügbarkeit erfolgen muß. Unter vielen Bedingungen stellt
der line­are Elektronentransport einen Überschuß an Elektronen bereit,
der zu einer Überreduktion und auch nachhaltigen Schädigung der
Elektronentransportketten durch Photoinhibition führen würde, falls
keine weiteren Akzeptoren vorhanden wären.
Die „Überschußelektronen“ stehen dann für N- und S-Assimilation,
Stärkesynthese, Protein- und Fettsäurebiosynthese und den
Sekundärstoffwechsel zur Verfügung oder werden über ver­schiedene „poising“-Mechanismen,
wie Übertragung auf molekularen Sauerstoff, zyklischen
Elektro­nentransport oder das Malat-Ventil, unschädlich gemacht. Als
weitere konsumierende Reaktion ist die über das Ferredoxin/Thioredoxin
(Fd/Td)-System vermittelte Licht/Dunkel-Modulation von
Chloro­plastenenzymen zu nennen. Durch diesen wichtigen Mechanismus
erfolgt die Adaptation des Chloroplasten-Metabolismus an
verschiedenste Bedingungen, um Limitierungen, verursacht durch einen
Mangel an ATP oder eine begrenzte Elektronen-Ver­fügbarkeit, zu
vermeiden. Neben der Regulation über den Redox-Zyklus werden die
Akti­vitä­ten dieser regulatorischen Enzyme über Intermediate des
Calvin-Zyklus eingestellt. Durch Untersuchungen an isolierten
Proteinen konnte der Einfluß spezifischer Effektoren gezeigt werden
und insbesondere im Fall der plastidären
Glycerinaldehyd-3-Phosphat-Dehydroge­nase (NAD(P)-GAPDH) besteht
relative Klarheit über die Art der Interaktion zwischen Effek­tor und
Reduktion. Wie an isolierten Chloroplasten nachgewiesen werden konnte,
sind sämt­liche aufgeführte Ak­zeptoren in einer strikten Hierarchie
organisiert. Die Reduktionen von H2O2 und Nitrit weisen im Vergleich
zur CO2-Assimilation höhere Affinitäten auf, während die Affinitäten
der „poising“-Mechanismen darunter angeordnet sind. Unter Bedingungen,
unter denen der Redoxstatus im Chloroplasten sich ändert (z.B.
hervorgerufen durch wech­selnde Lichtverhältnisse), begrenzt der
sensitivste Schritt die Rate der CO2-Fixierung.
Diese Arbeit soll nun einen Beitrag dazu leisten, kritische Schritte,
welche die Rate der Kohlen­stoffassimilation begrenzen, aufzuzeigen
und die dafür verantwortlichen Faktoren zu identifizie­ren. Dabei
steht die Analyse von Elektronenflüssen in verschiedenen Systemen und
unter ver­schiedenen Bedingungen im Vordergrund.
1.1 Bereitstellung von Energie: Der lineare Elektronentransport
Die in einem komplexen Muster in der Thylakoidmembran des
Chloroplasten lokalisierten Kompo­nenten des linearen
Elektronentransportes (Marder & Barber 1989) befähigen Pflan­zen, die
Strahlungsenergie aus dem Licht in chemische Energie umzuwandeln und
so für diver­se metabolische Prozesse zu nutzen. Bei diesem Prozeß
werden aus H2O stammende Elektro­nen über eine Reihe von
Redox-Komponenten auf ein höheres, energetisches Niveau gebracht, so
daß sie auf Fd, die erste lösliche Redox-Komponente des Stromas,
übertragen werden kön­nen.
Die Lichtabsorption erfolgt dabei durch Chlorophylle der
Lichtsammelkomplexe („light har­vesting complex“, LHC I und II) der
Photosysteme I und II (PS I; PS II). Am PS II geht die
Anregungsenergie aus LHC II, einem lichtsammelnden Chlorophyll
a/b-Protein, über eine in­nere Antenne auf das Reaktionszentrum (P680)
über, das dadurch ein Elektron an den nachfol­genden Akzeptor, das
Phaeophytin, abgibt. Das entstandene P680+ hat ein derart niedriges
Re­dox­potential, daß es in Zusammenwirkung mit dem auf der Lumenseite
gelegenen Wasser­spaltungskomplex dem H2O Elektronen entziehen kann.
Die Spaltung von zwei Molekülen H2O führt zur Bildung von einem
Molekül O2 und zur Freisetzung von vier Elektronen und vier Protonen.
Die pola­rographisch meßbare O2-Freisetzung ist ein Maß für die linear
trans­portierten Mengen an Elektro­nen (Walker 1987). Dabei wird
allerdings nur die Nettoproduk­tion an O2 bestimmt, während parallel
ablaufende O2-verbrauchende Prozesse, wie z.B. die Mehler-Reaktion
(s. Kap. 1.3.4), die Oxygenase-Aktivität der RubisCO oder die O2-Aufnahme
durch die Mitochondrien sowie der zyklische Elektronentransport
(s. Kap. 1.3.4), der nicht mit O2-Freisetzung verbunden ist, über
diese Methode nicht erfaßt werden. Eine stabile Ladungs­trennung wird
durch die Weiterleitung eines Elektrons auf QA, einer weiteren
Komponente des PS II, erreicht. Der nächste Schritt stellt dann einen
Übergang auf den Zwei-Elektronen-Ak­zeptor QB dar, der nachfolgend die
beiden Elektro­nen an das in der Thylakoidmembran be­wegliche
Plastochinon (PQ) abgibt (Trebst 1994).
Voraussetzung für diesen Elektronenfluß im PS II ist, daß genügend
Akzeptoren in oxidierter Form vorliegen. Andernfalls wird die
überschüssige Anregungsenergie in Form von Fluores­zenz und Wärme
abgegeben (Schreiber et al. 1994), um eine Schädigung des
Photosynthese­apparates zu vermeiden. Über die Bestimmung der
Fluoreszenz (mittels Puls-Amplituden-mo­dulierter Meßmethode), die
sich komplementär zur Aktivität des PS II verhält, können der
Re­duktionsgrad von QA, der Elektronenfluß durch PS II und weitere
Faktoren, die nicht mit der photochemischen Nutzung verbunden sind,
bestimmt werden (Schreiber et al. 1986, Walker 1987, Genty et al. 1989).
Neben der Energieabgabe in Form von Fluoreszenz verfügen Pflanzen über
weitere Mechanis­men, die bei z.B. Akzeptorlimitierung im Stroma oder
zu hohen Einstrahlungsintensitäten ei­nen Schutz vor Photodestruktion
von z.B. QB (Horton & Ruban 1985) durch langlebige An­regungs­zustände
in den LHC bieten (Foyer et al. 1990). Dies wird in den Antennen durch
die Bildung von Zeaxanthin aus Violaxanthin erreicht (Demmig-Adams & Adams
1992, Ru­ban et al. 1994), das unter Verbrauch von Ascorbat
regeneriert wird. Schutzfunktion bietet auch die reversible
Phosphorylierung des LHC II (Knaff 1991, Harrison & Allen 1991),
wodurch über eine Aus­wanderung der LHC aus den PS-Komplexen eine ca.
25%ige Reduktion der Antennengröße er­reicht wird (Demmig-Adams 1990).
In diesem Prozeß hat der Redox-Zustand des PQ regulatorische Funktion,
da reduziertes PQ zur Aktivierung einer Kinase führt, welche die
Phosphorylierung von Proteinen der Thylakoidmembran katalysiert (Allen et al. 1981).
Auch der Cytochrom b6/f-Komplex (Cyt bf), der die Elektronen von PQ
auf Plastocyanin überträgt, spielt eine Rolle in der
Kinase-Aktivierung und der Phosphorylie­rung von diversen
Untereinheiten des PS II-Komplexes (Vener et al. 1998). Die
Phosphorylie­rung der D1-Untereinheit des PS II-Reaktionszentrums
reguliert weiterhin die Repa­ratur photo­inhibitorischer Schäden von
PS II (Anderson & Aro 1997). Neben der anhaltenden, als
Photoinhibition bezeichneten Inaktivierung des PS II, welche mit einem
Ab- und Aufbau der D1-Untereinheit einhergeht (Schäfer & Schmidt 1986,
Anderson & Aro 1997), kann über eine reversible, pH-abhängige
Inaktivierung von PS II (Krause & Behrend 1986, Krieger et al. 1993)
auch kurzfristig ein Überschuß an Lichtenergie bei verminderter
Energienutzung und Ver­teilung balanciert werden. Der diesen
Mechanismus auslösende steile pH-Gradient über die Thy­lakoidmembran
kommt durch die Protonenfreisetzung bei der Wasserspaltung und durch
den Protonentransport über die Thylakoidmembran zustande (Mitchell
1966, Rutherford 1989). Dabei werden beim Elektronenübergang vom QB
des PS II auf PQ zwei H+ transloziert. Auch der Übergang von PQ auf
Cyt bf ist mit einem Protonentransfer verbunden (Hope & Rich 1989,
Hope 1990). Die Relevanz dieser sogenannten Q-Zyklen ist unklar, da
sowohl eine obligate (Rich 1988) als auch eine variable Regulation (Gerst et al. 1994,
Heber & Walker 1992) diskutiert werden. Unter sättigendem Licht kann
der pH-Wert im Lumen auf pH 5,0 absin­ken (Heldt et al. 1974, Werdan et al. 1975,
Purczeld et al. 1978), wobei der pH-Wert im Stroma um etwa eine
Ein­heit auf pH 8,0 ansteigt.
Neben der regulatorischen Funktion ist der pH-Gradient die treibende
Kraft für die ATP-Syn­these (Portis & McCarty 1976,
Strotmann & Bickel-Sandkötter 1984, Junge 1989). Katalysiert wird die
Phosphorylierung von ADP und anorganischem Phosphat (Pi) zu ATP von
einem integralen, transmembranen Pro­teinkomplex, der ATP-Synthase
(Übersicht bei Cox et al. 1992). Die Regulation der Aktivität erfolgt
über Td-vermittelte Reduktion zweier spezifischer Cysteine in der -Untereinheit
des Enzyms (Kramer et al. 1990), das ATP/ADP-Verhältnis (Altvater-Mackensen & Strotmann
1988) und die Verfügbarkeit von Pi.
Vom Plastocyanin geht das Elektron auf das Reaktionszentrum P700,
einem Chlorophyll a-Dimer, über, das den ersten Elektronenakzeptor des
PS I darstellt (s. Abb. 1). Das PS I ist aus 11 Unter­einheiten
zusammengesetzt, die mit den Abkürzungen PsaA bis PsaF und PsaI bis
PsaM bezeich­net werden (Golbeck 1992). Alle Untereinheiten, bis auf
die an der Stromaseite gebundenen Untereinheiten PsaC-E, sind
membranüberspannend (Krauß et al. 1993). Die größten Unterein­heiten,
PsaA und PsaB (je 83 kDa), bilden den Kern des PS I. Je fünf
trans­membrane und zwei an der Membranoberfläche gelegene -Helices
von PsaA und PsaB schließen die weiteren Elektronen transportierenden,
Chlorophyll a enthaltenden Komponenten ein und trennen diese dadurch
von den Chlorophyll a-Molekülen der Antennenkomplexe (Schubert et al.
1997). Eine Verbin­dung zwischen diesen wird über zwei spezifische
Chloro­phyll a-Moleküle hergestellt. Die kleine­ren transmembranen
Untereinheiten (4-15 kDa) sind um die A/B-Proteine angeordnet. Die
weite­ren, sowohl spektroskopisch als auch biochemisch
identifizierten, intermediären Akzeptoren sind nach P700 die
Akzeptoren A0, ein Chlorophyll a-Monomer, A1 (Vitamin K) und Fx ([Fe4S4]-„cluster“).
Die terminalen Akzeptoren FA und FB, ebenfalls [Fe4S4]-Zentren, sind
an PsaC gebunden (Hayashida et al. 1987, HØj et al. 1987). PsaC ist
ein Fd-ähnliches Protein, das eine zwischen den [Fe4S4]-Clustern
lokalisierte und eine C-terminale Sequenzerweiterung enthält (Dunn & Gray
1988). Von diesen wird eine Interak­tion mit dem A/B-Heterodimer und
PsaD angenommen (Naver et al. 1996). Eine Interaktion besteht auch mit
PsaE (Jansson et al. 1996). Anhand von „cross-linking“-Studien konnte
eine direkte Interaktion von Fd mit PsaD (Zanetti & Merati 1987,
Pandini et al. 1999, Andersen et al. 1992, LeLong et al. 1994) und
PsaC (Fischer et al. 1998) nachgewiesen werden. Auch PsaE wird für
eine effiziente Fd-Reduktion benötigt (Rousseau et al. 1993). Nach dem
aktuellen PS I-Modell scheinen PsaD und PsaE für eine korrekte Bindung
von Fd an PS I verantwortlich zu sein, während durch PsaC die [Fe4S4]-Zentren
koordiniert werden, von denen die Elektronen auf Fd übertragen werden
können.

Abbildung 1: Schematische Darstellung des photosynthetischen
Elektronentransports und der Elektronenverteilung im
Chloroplastenstroma.
I m Schema ist die Rolle von Fd als zentraler
Elektronenverteiler besonders hervorgehoben. Die detail­lierte
Beschreibung der einzelnen Reaktionen ist dem Text zu entnehmen. Das
PS I ist als Monomer mit den größ­ten Untereinheiten, den Elektronen
transportierenden und Fd-bindenden Komponenten, dargestellt (in
An­lehnung an Schubert et al. 1997). Die Großbuchstaben kennzeichnen
die einzelnen PS I-Untereinheiten (A für PsaA usw.). :
nicht-assimilatorische Elektronenflüsse; : assimilatorische
Elektronenflüsse. Schema nach Backhausen (2000, unpubl.) modifiziert.
MV: Methylviologen, APX: Ascorbatperoxidase.
1.2 Fd: Rolle als zentraler Elektronenverteiler
Fd sind lösliche Eisen-Schwefel-Proteine und agieren als
Elektronenüberträger in vielen Redox-Reaktionen, die an zentralen
Stellen im Metabolismus lokalisiert sind (Arnon 1988). In höheren
Pflanzen vorkommende Fd enthalten ein Eisen-Schwefel-Zentrum vom
2Fe/2S Typ (Knaff & Hirasawa 1991). Diverse Fd-Isoformen wurden bis
jetzt ausschließlich in Plastiden identifiziert. Neben den
Chloroplasten kommt Fd in nicht-photosynthetisch aktiven
Leukoplasten-, Amyloplasten- und Chromoplasten-haltigen Geweben, wie
Spinatwurzeln (Morigaski et al. 1990), Rettichwurzeln (Wada et al. 1989),
etiolierten Keimlingen (Kimata & Hase 1989) und grünen und roten
Tomatenfrüchten (Green et al. 1991) vor. In diesen Fällen überträgt Fd
unabhängig vom Licht Elektronen von NADPH auf Fd-abhängige Enzyme, wie
z.B. Nitritreduktase (NIR), Sulfitreduktase, Fd-Glutamat-Synthase (Suzuki et al. 1985).
Aus photosynthetisch aktiven und aus nicht-grünen Geweben isolierte Fd
weisen sowohl in ihrer Aminosäurezusammensetzung als auch in den
biochemischen Charakteristika beträchtliche Unterschiede auf. In
Blättern sind mindestens zwei Fd-Isoformen (Fd I und Fd II) vorhanden.
In unreifen grünen Tomaten ändert sich das Fd-Expressionsmuster
während des Reifungsprozesses (Green et al. 1991; Obata et al. 1995;
Kamide et al. 1995; Aoki & Wada 1996).
Fd sind kernkodiert und werden als Präproteine im Cytoplasma
synthetisiert, die dann in das Plastidenstroma importiert und dort
posttranslational prozessiert werden. Über in vitro
„targeting“-Experimente konnte der Import von reifem Fd in isolierte
Chloroplasten gezeigt werden (Huismann et al. 1978; Wedel et al. 1988).
Für Fd I-kodierende cDNA-Klone wurden aus Silene pratensis (Smeekens et al. 1987),
Spinat (Wedel et al. 1988), Erbse (Elliott et al. 1989), A. thaliana
thaliana (Somers et al. 1990) und der C4-Pflanze Mais (Hase et al. 1995)
isoliert. Mit Ausnahme von Weizen (sechs Kopien pro haploidem Genom)
kommt Fd I in allen bis jetzt untersuchten Pflanzen als intronloses
Gen mit ein bis zwei Kopien vor. Die Expression der Fd I-Gene (fed 1)
ist in einer unüblichen Art und Weise durch Licht reguliert.
Vergleichbar mit anderen kernkodierten Chloroplastenenzymen erfolgt
eine stärkere Transkriptakkumulation im Licht als im Dunkeln. Daneben
existieren erhebliche Unterschiede zu anderen gut untersuchten
lichtinduzierbaren Genen, die ebenfalls über Kontrollprozesse auf
Ebene der Transkription reguliert werden. Ein auf im Dunkeln
angezogene Pflanzen applizierter Lichtimpuls verursacht einen weitaus
schnelleren Anstieg im fed 1-mRNA Gehalt, der für einen längeren
Zeitraum unter Phytochrom-Kontrolle bleibt, als für Transkripte
beobachtet wurde, welche für die kleine Untereinheit der RubisCO und
die Chlorophyll a/b-bindenen Proteine (cab) kodieren (Kaufman et al. 1986;
Elliott et al. 1989). An etiolierten Tabak- keimlingen und grünen
Tabakpflanzen, die mit chimären und/oder mutierten fed 1-Genen
transformiert wurden, konnte gezeigt werden, daß für eine vollständige
Antwort auf einen Lichtreiz Elemente im Gen benötigt werden, die
oberhalb und unterhalb der Initiation der Transkription lokalisiert
sind. Das interne Element wurde innerhalb des 5’-Bereichs der
transkribierten Region identifiziert und schließt Teile der
Transitsequenz und des reifen Proteins mit ein. Offenbar spielen die
„upstream“-Elemente eine wichtige Rolle während des Ergrünens, während
die internen Elemente in grünen Blättern von Bedeutung sind (Dickey et al. 1992;
Gallo-Meagher et al. 1992; Dickey et al. 1994; Caspar & Quail 1993;
Bovy et al. 1995). Für Weizen konnte weiterhin eine Oszillation in der
fed 1-Transkriptmenge demonstriert werden (Bringloe et al. 1995), so
daß die Transkription anscheinend einer circadianen Regulation
unterliegt, wie schon für die cab-Gene aus Weizen gezeigt wurde (Nagy et al. 1988).
In photosynthetisch aktiven Blättern fungiert Fd I, die dominierende
Isoform im Chloroplasten, als zentraler Elektronenverteiler zwischen
dem membrangebundenen, photosynthetischen Elektronentransport und den
Elektronen-verbrauchenden Sequenzen im Chloroplastenstroma. Nach
Aufnahme eines Elektrons vom PS I kann das dann reduziert vorliegende
Fd I direkt für die Stickstoffreduktion durch NIR (Vega et al. 1980)
und Glutaminsynthase (Knaff & Hirasawa 1991) sowie zur Reduktion von
Sulfit mittels Sulfitreduktase genutzt werden (Hirasawa et al. 1987).
Der größte Anteil der Elektronen wird allerdings für die Reduktion von
NADP durch die Fd-NADP-Reduktase (FNR) benötigt (Knaff & Hirasawa
1991). Das gebildete NADPH dient als Elektronen- bzw. Wasserstoffdonor
für viele während der CO2-Fixierung ablaufende reduktive Reaktionen.
Hauptsächlich sind hier die Umsetzung von 1,3bis-Phosphoglycerat
(1,3bisPGA) zu 3-Phosphoglycerat (3PGA) und Glycerinaldehyd-3-Phosphat
(GAP) via NAD(P)-GAPDH (Leegood 1996) und die Reduktion von Oxalacetat
(OAA) zu Malat durch das sogenannte Malat-Ventil anzuführen (Backhausen et al. 1994).
Im Fall der NADP-Malatdehydrogenase (NADP-MDH) und auch im Fall der
Glucose-6-Phosphat-Dehydrogenase (G6PDH) ist dem Pyridinnukleotid
(PN)-Redoxstatus, d.h. dem Verhältnis an NADPH/NADP + NADPH („anabolic
reduction charge“ (ARC)) auch eine regulatorische Funktion zuzuordnen
(Backhausen et al. 1994; Lendzian & Bassham 1975; Kitzmann 1996).
Dabei besteht ein linearer Zusammenhang zwischen dem jeweiligen
Aktivierungszustand der Enzyme und dem Reduktionsgrad des PN-„pools“.
Für den Chloroplasten scheint eine stabile Redoxsituation wichtig zu
sein, da unter „steady state“- und extremen Bedingungen sowie über
einen weiten Bereich an Strahlungsintensitäten nur geringe Änderungen
im Verhältnis meßbar sind (Takahama et al. 1981; Foyer et al. 1989;
Backhausen et al. 1994; Holtgrefe et al. 1997). In diesem Zusammenhang
liegen für intakte Systeme, neben den von Heineke et al. (1991)
bestimmten, kaum Daten vor, die umfassend Änderungen im ARC
(hervorgerufen durch z.B. variierte Lichtintensitäten) mit
Intermediat-Gehalten und den über beide Komponenten regulierten
Aktivitäten von Enzymen in Beziehung setzen.
Weiterhin existiert ein durch die Ferredoxin-Thioredoxin-Reduktase
(FTR) katalysierter Elektronenfluß auf Td, welche ebenfalls als
lösliche Elektronenüberträger fungieren und eine wichtige Rolle in der
„Lichtregulation“ von Schlüsselenzymen der Kohlenstoffassimilation und
im oxidativen Pentose-Phosphatweg einnehmen (vgl. 1.3).
Besteht im Chloroplasten weiterhin ein Überschuß an Elektronen, die
nicht für die beschriebenen metabolischen Prozesse benötigt werden,
werden diese auf Akzeptoren übertragen, die nicht Teil von
biosynthetischen Stoffwechselwegen sind. Diese werden als
„poising“-Mechanismen zusammengefaßt. Zu diesen Sequenzen gehört der
zyklische Elektronentransport (Bendall & Manasse 1995), die
Übertragung von Elektronen auf O2 (Polle 1996) und das schon
angesprochene Malat-Ventil (Backhausen et al. 1994; Fridlyand et al. 1998).
Eine detaillierte Behandlung erfolgt gesondert in Kapitel 1.3.4. Neben
diesen Reaktionen, in welchen zum Teil reaktive Sauerstoffspezies
erzeugt werden, dient Fd ebenfalls als Elektronendonor in sämtlichen
antioxidativen Stoffwechselwegen. Die Thylakoid-gebundene
Monodehydroascorbat-Dehydrogenase (MDA) bewirkt die Reduktion des
reduzierten Monodehydroascorbat-Radikals unter direktem Verbrauch von
reduziertem Fd (Groden & Beck 1979; Miyake & Asada 1994). Auch bei der
Umsetzung von H2O2 und Ascorbat zu Dehydroascorbat ist reduziertes Fd
indirekt beteiligt. Die Elektronen für die Ascorbat-Regeneration
stammen von reduziertem Glutathion (GSH), wobei das entstehende
oxidierte Glutathion (GSSG) durch die Glutathion-Reduktase mit NADPH
als Cofaktor re-reduziert wird (Foyer & Halliwell 1976; Foyer et al. 1983).
Möglicherweise sind die 1997 von Baier & Dietz entdeckten
Peroxiredoxine an einer Td-abhängigen Detoxifikation von H2O2 im
Stroma beteiligt.
In isolierten Spinatchloroplasten sind diese Elektronenakzeptoren in
einer strikten Hierarchie organisiert, wodurch eine Konkurrenz um
Elektronen und eine Akkumulation von toxischen
Stoffwechselintermediaten vermieden wird (Backhausen et al. 2000). Die
Entgiftung von H2O2 und Nitrit hat den Vorrang vor der Assimilation
von CO2, während danach erst überschüssige Elektronen durch das
Malat-Ventil und den zyklischen Elektronentransport entsorgt werden.
Molekularer O2 hat die niedrigste „Affinität” zu Elektronen. Die
strukturelle Grundlage in diesem Zusammenhang ist aber noch unklar.
Sämtliche Reaktionen sind abhängig vom Redoxstatus bzw. der Menge an
vorhandenem Fd und vermutlich auch abhängig von den Affinitäten zu den
Elektronen-konsumierenden Reaktionen, da Fd jeweils als
Elektronendonor/-akzeptor fungiert. Über den Fd-Gehalt im
Chloroplasten liegen leider sehr differierende Daten vor, so daß keine
konkrete Aussage über die tatsächliche Menge gemacht werden kann. Die
Angaben schwanken zwischen 0,1 mM (Böhme 1977), 0,86 mM (Furbank & Badger
1983) und 2,1 mM (Robinson 1988), wobei allerdings niedrigere Werte
zwischen 0,1-0,2 mM als realistisch angenommen werden (Siebke et al. 1991;
Scheller 1996).
Hinsichtlich der in in vitro-Experimenten bestimmten Affinitäten für
reduziertes Fd besteht ebenfalls Unklarheit. Für FNR ist eine
Sättigung bei 0,33 mM (Shin et al. 1974) oder 10-20 µM (Furbank & Badger
1983) erreicht, während die Affinität von MDA-Reduktase zu Fd mit
30fach höheren Werten beschrieben wurde (Miyake & Asada 1994). In
vitro werden 30 µM des gesamten Fd von der NIR benötigt (Baysdorfer & Robinson
1985) und die NIR kann in vivo erfolgreich mit dem Malat-Ventil um
Elektronen konkurrieren (Backhausen et al. 1994). Die Sättigung der O2-Reduktion
benötigt 70 µM (Furbank & Badger 1983) und für den
Antimycin A-sensitiven zyklischen Elektronentransport liegen Messungen
von 5 µM (Scheller 1996) und 50-100 µM (Robinson & Yokum 1880) vor,
während für den Antimycin A-insensitiven Weg 75 µM Fd gebraucht werden
(Scheller 1996). Diese in vitro bestimmten Werte müssen allerdings
nicht den realen, in vivo benötigten Mengen an reduziertem Fd
entsprechen. So kann angenommen werden, daß während der Photosynthese
die verschiedenen Elektronenüberträger nicht im Gleichgewicht
miteinander stehen. Weiterhin liegt die Konzentration des reduziert
vorliegenden Fd in vivo wahrscheinlich unter 2 µM, was einem
Reduktionsgrad von 3% des gesamten „pools“ entspricht (Siebke et al. 1991),
und überschreitet nicht Werte von 10% der Gesamtmenge (Hosler & Yokum
1987).
Aus diesen Tatsachen kann geschlußfolgert werden, daß die Menge an
reduziertem Fd sowohl in der Kurzzeit- als auch in der
Langzeitregulation der Photosynthese eine entscheidene Rolle spielen
kann. Über diese Annahme liegen in der Literatur noch keine
Untersuchungen vor.
1.3 Elektronenakzeptoren im Stroma
1.3.1 FTR und Td
Von Fd aus wird ein Teil der Elektronen auf FTR übertragen, welches
dann in der Lage ist, Td zu reduzieren. Das Fd/Td-System stellt ein
rein regulatorisches System dar, durch das die Aktivitäten diverser
Chloroplastenenzyme moduliert werden (Buchanan 1980).
FTR ist ein Eisen-Schwefel-Protein und setzt sich aus zwei
verschiedenen Untereinheiten zusammen (Tsugita et al. 1991). Die
katalytisch aktive Untereinheit B ist sowohl in der Größe (13 kDa) als
auch in der Aminosäure-Zusammensetzung zwischen verschiedenen Spezies
hoch konserviert, während die A-Untereinheit sehr variabel ist. Die
Molekulargewichte liegen zwischen 7 kDa (Nostoc mucorosum) und 17,2
kDa (Spinacia oleracea) (Droux et al. 1987a). Die B-Untereinheit
enthält ein [4Fe-4S]-Zentrum und eine redox-aktive Disulfidbrücke, die
bei der Elektronenübernahme vom Fd reduziert wird (Droux et al. 1987a,
1987b, Crawford et al. 1989, Chow et al. 1995). Der zu Grunde liegende
Mechanismus scheint auf einer großen räumlichen Nähe zwischen der
Disulfid-Brücke des Proteins und dem [4Fe-4S]-Zentrum sowie der
Struktur des Enzyms, die eine Bindung von Fd auf der einen und Td auf
der anderen Seite ermöglicht, zu beruhen (Dai et al. 2000a und 2000b).
Nach Aufnahme eines Elektrons von Fd liegt ein gemischtes Disulfid mit
Td vor, während das zweite dazu benötigte Elektron aus dem
[4Fe-4S]-Zentrum stammt. In diesem intermediären Zustand liegt dieses
dann oxidiert vor und wird durch ein Elektron eines neuen Fd-Moleküls
wieder in den Grundzustand gebracht. Dies führt zur Reduktion der
Disulfidbrücke zwischen dem Cystein der FTR und dem Cystein des Td, so
daß das reduzierte Td freigesetzt wird. Die Rolle der variablen
Untereinheit ist demgegenüber nicht so eindeutig. Als wichtige
Funktion wird die Stabilisierung des Fe-S-Zentrums angesehen, da die
meisten an der Interaktion zwischen den Untereinheiten beteiligten
Aminosäurereste konserviert sind (Dai et al. 2000a).
Td sind eine Klasse niedermolekularer Proteine, deren Einteilung nach
der Spezifität für die Zielenzyme erfolgt ist (Tdf:
Fructose-1,6-bisphosphatase (FBPase); Tdm: NADP-MDH; Buchanan 1980).
Sie fungieren als Elektronenüberträger, welche die von der FTR
aufgenommenen Elektronen auf die verschiedenen Enzyme im Stroma
übertragen. Diese kovalente Redoxmodifikation wird durch einen
Thiol/Disulfid-Austausch von regulatorischen Cysteinresten in den
Proteinen verursacht, die dadurch in ihrer Aktivität gesteigert oder
gehemmt werden (Buchanan 1980; Droux et al. 1987). Wie an isolierten
Proteinen gezeigt werden konnte, wird der Anteil an aktiv vorliegendem
Enzym nicht nur über den Elektronendruck, sondern außerdem auch durch
für die jeweiligen Enzyme spezifischen Stoffwechselintermediate
eingestellt (Scheibe 1990; Faske et al. 1995). Somit bewirkt dieser
regulatorische Elektronenfluß nicht ein einfaches An- und Ausschalten
der Enzyme, sondern über den additiven, komplexen
Regulationsmechanismus kann die aktuelle Aktivität der metabolischen
Situation angepaßt werden (Faske et al. 1995).


Abbildung 2: Schematische Übersicht über die wesentlichen Elektronen-
und ATP-verbrauchenden Schritte im Chloroplastenstroma.
Die gelbunterlegten Zahlen stehen für die verschiedenen durch Td
aktivierten bzw. inaktivierten Enzyme: 1: NAD(P)-GAPDH, 2: FBPase, 3:
SBPase, 4: PRK, 5: G6PDH (im Licht inaktiv), 6: NADP-MDH, 7: ATPase.
Andere T: andere Translokatoren; DT: Dicarbonsäure-Translokator;
OAA-T: OAA-Translokator; TPT: Triosephosphat-Translokator. Weitere
Erläuterungen siehe Text. Schema nach Backhausen (2000, unpubl.)
mo­difiziert.
1.3.2 Der Calvin-Zyklus
Der größte Anteil der durch die Primärreaktionen bereitgestellten
Energie- und Reduktionsäquivalente in Form von ATP und NADPH wird für
die Fixierung von CO2 im Calvin-Zyklus benötigt. Da diesem
Stoffwechselkreislauf neben der Funktion der Regeneration des CO2-Akzeptors
Ribulose-1,5-bisphosphat (RuBP) auch die Aufgabe zukommt, die
Stärkesynthese und die Saccharosesynthese mit den entsprechenden
Metaboliten zu versorgen, ist für einen optimalen Ablauf eine auf
exogene und endogene Faktoren abgestimmte Einstellung von
Metabolitkonzentrationen der einzelnen Reaktionssequenzen
unerlässlich. Die Regulation erfolgt über eine komplexe Anpassung von
Enzymaktivitäten an die jeweilige metabolische Situation. Auf diese
Weise wird verhindert, daß bestimmte Stoffwechselinter-mediate
anstauen bzw. ganze Intermediatspiegel verarmen.
Eine entscheidende Rolle in diesem Zusammenhang spielt die Reduktion
und die gleichzeitig auftretende Reoxidation von regulatorischen
Disulfidbrücken in verschiedenen Enzymen. Die Reduktion wird durch
Übertragung von Elektronen über Fd, FTR und spezifische Td auf die
Zielenzyme erreicht (s. 1.3.1), wobei die Reoxidation in vivo nicht
endgültig geklärt ist. Als Oxidationsmittel werden molekularer
Sauerstoff, Glutathion, Dehydroascorbat und das durch O2 oxidierte Td
diskutiert. (Scheibe 1990, Creighton 1984, Gilbert 1984). Zur
Aufrechterhaltung dieses Redoxzyklus ist somit ein stetiger
Elektronenfluß von PS I über Fd notwendig.
Enzyme, die auf diese Weise reguliert werden, sind u.a. NAD(P)-GAPDH,
FBPase, Seduheptulose-1,7-bisphosphatase (SBPase) und
Phophoribulokinase (PRK) (s. Abb. 2). Neben diesem Mechanismus wird
sowohl der Vorgang der Reduktion als auch der resultierende
Aktivierungszustand der Enzyme durch Interaktion mit stromalen
Metaboliten feinreguliert. Weiteren Einfluß haben je nach Enzym
ebenfalls pH-Wert, Mg2+-Konzentration und die vom Licht
hervorgerufenen Änderungen im Adenylat- und PN-Spiegel.
Die im reduktiven Teil des Calvin-Zyklus lokalisierte NAD(P)-GAPDH
wird durch das Substrat 1,3bisPGA aktiviert, indem das Enzym in vier
katalytisch aktive Untereinheiten zerfällt. Diese Aktivierung erfolgt
bei den in vivo auftretenden 1,3bisPGA-Konzentrationen nur am bereits
reduzierten Enzym, wodurch eine Anpassung an den stromalen Gehalt an
1,3bisPGA und das [ATP]/[ADP]-Verhältnis erfolgt (Baalmann et al. 1994,
1995). Die Reduktion der isolierten FBPase durch Dithiotreitol (DTT)
wird in Gegenwart des Substratanalogons Ca-Fructose-1,6-bisphosphat
(CaFBP) erleichtert, indem das Redoxpotential des Enzyms stark
herabgesetzt wird (Faske et al. 1995). Als möglicher Katalysator in
vivo ist das katalytische Substrat (FBP4-Mg2+)2- (Gardemann et al. 1984)
oder auch das unkomplexierte FBP (Chehebar & Wolosiuk 1981) denkbar.
Da die Bildung des Substratkomplexes pH- und Mg2+-abhängig ist (Gardemann et al. 1984)
und sinkende pH-Werte die Konformation des Enzyms in Richtung der
inaktiven Form verschieben (Minot et al. 1982, Gontero et al. 1984,
Pradel et al. 1986), liefern die beim Licht/Dunkel-Übergang
auftretenden Änderungen in der Mg2+- und H+-Konzentration (Heldt 1979)
eine Erklärung für die langsame Inaktivierung des Enzyms während
längerer Dunkelphasen (Gardemann et al. 1984). Demgegenüber erfolgt
neben der sehr schnellen, essentiellen Aktivierung durch Reduktion die
Feinregulation der PRK eher auf katalytischer Ebene (Gardemann et al. 1983,
Porter et al. 1988, porter 1990). Die Aktivität des Enzyms wird durch
3PGA, RuBP, 6-Phosphogluconat, FBP, Pi (kompetitiv zu Ru5P) und ADP
(kompetitiv zu ATP) gehemmt. Während der Photosynthese drosseln diese
Hemmstoffe die Aktivität soweit, daß die PRK zu einem
ratenlimitierenden Enzym wird (Gardemann 1983). Die inhibitorische
Wirkung von 3PGA, 6-Phosphogluconat, FBP und Pi wird durch
Erniedrigung des pH-Wertes verstärkt, so daß beim
Licht/Dunkel-Übergang, unabhängig vom Lichtaktivierungszustand des
Enzyms, eine sofortige Inaktivierung eintritt (Gardemann 1983).
Eine entscheidende Bedeutung für den optimalen Ablauf der CO2-Fixierung
hat auch Pi durch den Bedarf bei der ATP-Synthese und den strikten
Austausch mit Produkten der CO2-Fixierung, den Triosephosphaten (TP)
GAP und Dihydroxyacetonphosphat (DHAP), die im Cytosol für die
Saccharosesynthese benötigt werden. Zur Regeneration des CO2-Akzeptors
RuBP müssen 5/6tel des gebildeten DHAP im Stroma verbleiben, so daß
die Regulation der Saccharosesynthese über die Freisetzung von Pi und
den Bedarf an Triosephophaten direkt in die Photosynthese und die
Bildung von transitorischer Stärke im Chloroplastenstroma eingreifen (Cseke & Buchanan 1986,
Neuhaus et al. 1990). Eine gedrosselte Saccharosesynthese führt im
Stroma zu einer Akkumulation von TP und einem verringerten Pi-Gehalt.
Durch dieses erhöhte PGA/Pi-Verhältnis erfolgt über die Aktivierung
der ADP-Glucose-Pyrophosphorylase der Einbau von DHAP in
transitorische Stärke (Copeland & Preiss 1981).
Von weiterer entscheidender Bedeutung für die Regulation der
Photosynthese ist die Einstellung eines optimalen
[ATP]/[NADPH]-Verhältnisses. Für die Fixierung von einem Molekül CO2
im Calvin-Zyklus benötigen die Reaktionen der 3-Phosphoglycerat-Kinase
(PGK), der NAD(P)-GAPDH und der PRK drei ATP und zwei NADPH, woraus
sich ein Verhältnis von 1,5 ergibt. Dieser Wert liegt über den Angaben
von 1,1-1,3, die zur Stöchiometrie der Bereitstellung von ATP/NADPH in
vivo bestimmt wurden (Heber & Kirk 1975, Ort & Melandri 1982, Badger
1985). Daraus errechnet sich eine Überkapazität von NADPH von
0,25 µmol NADPH pro freigesetztem µmol O2. Der Bedarf an ATP wird
durch Photorespiration und Stärkesynthese weiter erhöht, während der
Verbrauch durch die Chloroplasten-Hüllmembran-ATPase noch unklar ist (Wu & Berkowitz
1992, Berkowitz & Peters 1993). Da unter Lichtsättigung bedeutend mehr
Elektronen zur Verfügung stehen als für die CO2-Fixierung benötigt
werden, muß der Chloroplast über weitere Elektronen- oder
NADPH-konsumierende Reaktionen verfügen, die den Reduktionsgrad der
Elektronentransportketten an den pH anpassen und auf diese Weise für
ein ausbalanciertes [ATP]/[NADPH]-Verhältnis sorgen. Diese spezifische
Entsorgung der „Überschußelektronen“ erfolgt durch den zyklischen
Elektronenfluß, das Malat-Ventil und die Reduktion von O2
(s. Kap. 1.3.4). Eine Anpassung der Reaktionen im Calvin-Zyklus muß
aber auch an Bedingungen erfolgen, die durch eine verminderte
Verfügbarkeit von Elektronen, wie z.B. sich schnell ändernde
Lichtverhältnisse, gekennzeichnet sind.
Für die redoxmodulierten Enzyme liegen Daten über Aktivitätsänderungen
beim Licht/Dunkel-Übergang und Messungen der Metabolite vor, die die
Aktivitätseinstellung beeinflussen. Aber von großem Interesse wären
umfangreiche parallele Bestimmungen von Änderungen im Elektronendruck,
pH, in den Enzymaktivierungszuständen und in den Metabolitspiegeln,
um die sensitiven Schritte zu identifizieren, welche die CO2-Fixierung
begrenzen.
1.3.3 Nitritreduktion
Die Stickstoffassimilation stellt wie die CO2-Fixierung einen der
reduktiven Stoffwechselwege dar, der reduziertes Fd und ATP benötigt
und somit an den lichtgetriebenen Elektronenfluß gekoppelt ist. Die
Stickstoffaufnahme erfolgt hauptsächlich als oxidiert vorliegendes
Nitrat, wobei für den Einbau in organische Verbindungen ausschließlich
die reduzierte Form, NH4+, genutzt wird. Die Reduktion von Nitrat wird
im Cytosol durch die Nitratreduktase (NR) unter Verbrauch von zwei aus
NADH stammenden Elektronen katalysiert. Das gebildete Nitrit gelangt
in den Chloroplasten, wobei eine Transporter-vermittelte Translokation
(Nasse 1993) oder eine Aufnahme über pH-sensitive Kanäle diskutiert
werden (Brunswick & Cresswell 1988). Im Stroma reduziert die NIR das
Nitrit mit Hilfe von sechs Elektronen zu NH4+, das nachfolgend durch
Aminierung von Glutamat durch die Glutamin-Synthetase in Glutamin
umgewandelt wird. Diese Reaktion benötigt ein ATP. Glutamin und -Ketoglutarat
stellen dann die Substrate der Glutamin:Oxoglutarat-Aminotransferase
dar. Unter Verwendung von weiteren zwei Elektronen führt dies zur
Bildung von zwei Molekülen Glutamat. Sämtliche für diese Sequenzen
benötigten Elektronen stammen aus reduziertem Fd, so daß die
Assimilation von 1 Mol Nitrit für die Nettoproduktion von 1 Mol
Glutamat 8 Mole reduziertes Fd und 1 Mol ATP verbraucht. Demnach hat
dieser Stoffwechselweg nach der CO2-Fixierung den höchsten
Elektronenbedarf (Turpin & Weger 1990) und daher ist eine Kompetition
mit der CO2-Fixierung denkbar (Robinson 1988a, 1988b). Im
rekonstituierten Chloroplastensystem und bei Algen konnte eine Abnahme
der CO2-Fixierung bei gleichzeitiger Nitrit-Reduktion gezeigt werden,
während in Chloroplasten und in isolierten Mesophyllzellen unter
sättigendem Licht und CO2 diese Beeinflussung nicht nachweisbar war,
so daß eine Konkurrenz um Elektronen in vivo wohl nicht vorhanden ist
(Robinson 1988b). Dafür spricht auch der viel geringere Km-Wert der
FNR von 0,33 µM (Shin 1974) im Vergleich zu dem der NIR von 10 µM (Losada & Paneque
1974) bzw. 25 µM (Schomburg et al. 1994). Demgegenüber konnte an
isolierten, intakten Spinatchloroplasten gezeigt werden, daß die
Übertragung von Elektronen auf Nitrit eine klare Präferenz vor der CO2-Assimilation
besitzt (Backhausen et al. 2000). Dies ist wohl größtenteils auf die
toxische Natur von Nitrit zurückzuführen. Akkumulationen von Nitrit im
Stroma können eine Senkung des stromalen pH-Wertes bewirken und auf
diese Weise die FBPase-Aktivität inhibieren (Purczeld et al. 1978).
Ebenfalls besteht die Möglichkeit einer Komplexierung von SH-Gruppen
in regulatorischen Proteinen, wie z.B. Td oder FTR, mit Nitrit und
eine daraus resultierende verminderte Aktivierung redoxmodulierter
Enzyme (Robinson 1998a). In vivo treten toxische
Nitrit-Konzentrationen nicht auf, da die Nitritsynthese unter strenger
Kontrolle der NR steht (Foyer et al. 1994) und so eine negative
Beeinflussung des C-Stoffwechsels vermieden wird. Die Aktivität der NR
wird durch Phosphorylierung (Huber et al. 1992), Veränderungen in Mg2+-
(Riens & Heldt 1992), Phosphat- (Sanchez & Heldt 1992) und
Adenylat-Konzentrationen (Kaiser et al. 1992) reguliert. Eine CO2-Limitierung
führt zur Hemmung der NR, so daß eine enge Wechselwirkung zwischen C-
und N-Stoffwechsel besteht. Durch eine fünfmal höhere Aktivität und
auch einen sehr viel geringeren Km-Wert der NIR für Nitrit gegenüber
der NR für Nitrat ist eine sofortige Reduktion von Nitrit zu NH4+
gewährleistet, so daß es nicht zu einer Akkumulation von Nitrit im
Stroma kommt (Layzell 1990).
1.3.4 Alternative Elektronenakzeptoren und andere
„poising“-Mechanismen
Zu den alternativen Elektronenakzeptoren werden solche aus
Elektronen-konsumierenden Stoffwechselwegen gerechnet, in denen
ausschließlich Elektronen verbraucht werden, die nicht für die N-, S-
oder C-Assimilation benötigt werden und deshalb keine Konkurrenz zu
diesen darstellen (Backhausen et al. 1994, 2000). Über diese
Reaktionen erfolgt eine Stabilisierung des Redoxstatus im
Chloroplastenstroma (Backhausen et al. 2000), der für eine optimale CO2-Fixierung
notwendig ist. Diese „Überschußelektronen“ fallen unter sättigendem
Licht an, da der photosynthetische Elektronentransport immer mehr
Elektronen liefert als für die biosynthetischen Stoffwechselwege
benötigt werden (Stitt 1986). Weiterhin erzeugt eine schnell sich
erhöhende Lichteinstrahlung sowie auch eine CO2-Limitierung einen
hohen Überschuß an Elektronen. Diese müssen dann, um z.B. Schädigungen
der Elektronen-transportierenden Membrankomponenten und
Antennenkomplexe zu vermeiden, entsorgt werden. Eine schnelle
Anpassung wird durch Schutzmechanismen vermittelt, ohne daß die
Zusammensetzung von Proteinen in den Thylakoidmembranen beeinflußt
wird. Neben den alternativen Akzeptoren nutzt die Pflanze weitere
Mechanismen, wie nicht-photochemische Ableitung von Lichtenergie in
PS II (Horton et al. 1996), LHC II-Phosphorylierung („state
transitions“), eine Verringerung der Elektronentransportrate über pH-induzierte
Inaktivierung von PS II (Foyer et al. 1990, Krieger & Weis 1993) und
eine verringerte Effizienz der P700-Oxidation bzw.
PS I-Photoinhibition (Terashima et al. 1994, Ivanov et al. 1998).
Das Malat-Ventil setzt sich aus drei diskreten Reaktionssequenzen
zusammen. Das im Stroma benötigte Oxalacetat (OAA) wird über einen
hochaffinen Translokator (Km für OAA = 9 µM) aus dem Cytosol
aufgenommen (Hatch et al. 1984). Unter Verbrauch von NADPH setzt die
NADP-MDH das OAA zu Malat um, das über Dicarbonsäure-Translokatoren
mit überlappenden Spezifitäten für OAA und Malat wieder ins Cytosol
exportiert wird (Heldt & Flügge 1987, 1992). Durch den Verbrauch an
NADPH und die flexible Regulation der NADP-MDH ist das Malat-Ventil
besonders geeignet, das stromale ATP/NADPH-Verhältnis zu balancieren (Scheibe
1987, Backhausen et al. 1994, 2000). Grundlegend erfolgt dies über
regulatorische Disulfidbrücken (vgl. Kap. 1.3.1), die im Licht
spezifisch durch Tdm zu Sulfhydrylgruppen reduziert werden und auf
diese Weise zu einer Aktivierung des Enzyms führen (Scheibe & Jacquot
1983, Ferté et al. 1984, Scheibe 1991). Eine Feinregulation erfolgt
über das stromale NADPH/NADP-Verhältnis, indem ein hohes Verhältnis
die Enzymaktivität in Richtung aktive Form verschiebt
(Scheibe & Jacquot 1983). Eine Hemmung der Enzymaktivität und auch der
Enzymaktivierung wird durch NADP hervorgerufen, welches auch Produkt
der Reaktion ist. Am isolierten Enzym ist das Ausmaß dieser Hemmung
nicht von der eingesetzten Gesamtkonzentration an NADPH plus NADP
abhängig, sondern wird durch die Menge an NADP bestimmt (Faske et al. 1995).
Dies bedeutet, daß ein sinkender ARC die Enzymaktivität inhibiert. Die
aktuelle Enzymaktivität im Licht ist dann das Ergebnis aus dem
Zusammenspiel aus Elektronendruck, der über Tdm den Anteil von
reduzierter zu oxidierter Enzymform reguliert, und dem stromalen
NADP/NADPH-Verhältnis. An isolierten Chloroplasten konnte gezeigt
werden, daß der Elektronendruck, bestimmt als qP, und der ARC immer
parallel verlaufen. Schon geringe Verschiebungen im stromalen
Redoxzustand führen zu einer veränderten NADP-MDH-Aktivität und damit
wird ein Verbrauch von NADPH und Elektronen über das Malat-Ventil bei
sinkendem Redoxstatus verhindert (Backhausen et al. 1994, Holtgrefe et al. 1997).
Auf diese Weise trägt das Malat-Ventil in isolierten Chloroplasten zur
Stabilisierung des stromalen ATP/NADPH-Verhältnisses bei und
konkurriert nicht um Elektronen, die für CO2- und Nitritreduktion
benötigt werden (Backhausen et al. 1994, 2000). In vivo-Aktivitäten
der NADP-MDH können daher für Aussagen über den stromalen Redoxzustand
genutzt werden (Scheibe & Jacquot 1983, Scheibe & Stitt 1988, Foyer et al. 1992,
Backhausen et al. 1994).
Neben der Tatsache, daß bei dieser Reaktionssequenz keine toxischen
Intermediate wie H2O2 oder O2-Radikale entstehen, deren Entgiftung
einen weiteren Verbrauch von NADPH zur Folge hätte (vgl. Kap. 1.2),
bietet das Malat-Ventil für die Pflanze den Vorteil, daß überschüssige
Reduktionskraft dem Stoffwechsel in Form von Malat zur Verfügung
gestellt werden kann. Malat ist ein Substrat, das von der Zelle auf
vielfältige Weise genutzt wird (Lance & Rustin 1984,
Martinoia & Rentsch 1994, Gardeström 1996).
Beim Antimycin A-sensitiven, zyklischen Elektronentransport werden
Elektronen von Fd (Arnon & Chain 1979) wieder auf PQ übertragen, was
mit einer Translokation von Protonen in das Lumen gekoppelt ist (Fork & Herbert
1993). Ob diese Übertragung auf PQ enzymatisch durch eine postulierte
PQ-Reduktase oder durch FNR vermittelt wird, ist nach wie vor unklar (Cleland & Bendall
1992, Bendall & Menasse 1995). Als weiterer Akzeptor innerhalb der
Elektronentransportkette kann die zum Stroma gerichtete Bindestelle
für PQ des Cyt bf-Komplexes dienen (Moss & Bendall 1984). Von dort
gelangen die Elektronen über Cyt 563, Cyt c und Plastocyanin wieder
zum PS I und Fd. Eine Quantifizierung dieses zyklischen
Elektronenflusses kann in intakten Blättern durch einen Vergleich der
Flüsse durch PS II und PS I erfolgen (Harbinson et al. 1989, 1990,
Harbinson & Foyer 1991), während in isolierten Chloroplasten der
Anteil durch Hemmung mit Antimycin A bestimmt werden kann (Arnon 1969).
In vivo beträgt der Anteil des zyklischen Elektronentransportes
wahrscheinlich nicht mehr als 3% (Bendall & Manasse 1995).
Demgegenüber weisen isolierte Thylakoide Maximalraten von
40 µmol ATP · mg Chl-1 · h-1 auf (Rurainski et al. 1987). Obwohl über
die Bedingungen unter denen der zyklische Elektronentansport Bedeutung
gewinnt divergierende Befunde vorliegen, wird ihm bei
Akzeptorlimitierung während der Photosynthese die Funktion zugeordnet,
das ATP/NADPH-Verhältnis an den stromalen Bedarf anzupassen (Furbank & Horton
1987, Hosler & Yokum 1987, Harbinson & Foyer 1991, Katona et al. 1992).
Als weitere Funktionen sind der Schutz vor Photoinhibition über den
Aufbau eines hohen pH und die nachfolgende Hemmung von PS II sowie
die Bereitstellung von ATP für verschiedene zelluläre Reaktionen zu
nennen (Bendall & Menasse 1995).
Die Übertragung von Elektronen auf molekularen O2, auch als
Mehler-Reaktion (Mehler 1951) oder pseudozyklischer
Elektronentransport bezeichnet, wird durch Fd oder direkt von
Fd-freiem PS I vermittelt und stellt somit eine
nicht-enzymkatalysierte Reaktion dar. Die O2-Reduktion führt zur
Erzeugung von Superoxid-Radikalen, die sofort durch die lösliche oder
membranständige Superoxid-Dismutase (SOD) in H2O2 umgewandelt werden.
Dieses für die Zelle äußerst toxische Intermediat wird
schnellstmöglich über zwei antioxidative Stoffwechselwege entgiftet
(s. Kap. 1.2). Schon in Konzentrationen von 10 µM bewirkt H2O2 eine
50%ige Inhibierung der CO2-Assimilation, indem es die SH-Gruppen in
redoxmodulierten Enzymen oxidiert (Polle 1996). Die Rate der O2-Reduktion
hängt stark vom experimentellen System (Thylakoide, Chloroplasten,
Zellen) und der Verfügbarkeit von zusätzlichen Elektronenakzeptoren ab
(Robinson & Gibbs 1982, Furbank et al. 1982, Furbank & Badger 1983).
So liegt der Km-Wert für O2 in Fd-freien PS I-Präparationen mit
3-10 µM sehr niedrig (Asada et al. 1982, Asada & Nakano 1978) und
steigt auf Werte um 60 µM, wenn die Messung unter Zusatz von Fd
erfolgt (Furbank et al. 1982, Furbank et al. 1982, Asada & Takahashi
1987). Messungen an intakten Blättern ergaben ähnliche Ergebnisse, so
daß die Mehler-Reaktion in Systemen, in denen Elektronenproduktion an
verbrauchende Reaktionen (wie Photorespiration oder CO2-Fixierung)
gekoppelt ist, wohl sehr niedrig ist (Polle 1996). Die Funktion dieser
Sequenz ist dann während der Induktionsphase der Photosynthese, in der
die Enzyme des Calvin-Zyklus aktiviert und der pH-Gradient zur
ATP-Synthese aufgebaut werden, die Ableitung überschüssiger
Elektronen, bis wieder ausreichend NADP zur Elektronenaufnahme zur
Verfügung steht (Takahama et al. 1981, Polle 1996).
1.3.5 Sonstige über Redox-Wechsel regulierte Enzyme
Aus den geschilderten Reaktionen wird die Bedeutung von Fd in der
Verteilung von Elektronen auf diverse stromale Akzeptoren deutlich.
Dabei kommt einigen die Aufgabe zu, Fd im oxidierten Zustand zu
halten, damit eine mehr oder weniger konstante Versorgung mit
Elektronen erfolgen kann. In diesem Zusammenhang ist dann bei einer
über einen längeren Zeitraum andauernde Verschiebung im Redoxzustand
von Fd auch ein Einfluß auf die Genexpression und Translation von
kern- und plastidenkodierten Chloroplastenproteinen möglich. Die
lichtinduzierte Steigerung der Translation von Chloroplastenenzymen
beträgt das 50- bis 100fache, ohne daß ein Einfluß auf die
mRNA-Gehalte zu verzeichnen ist (Fromm et al. 1985, Danon & Mayfield 1994,
Levings & Siedow 1994). Dabei wird ver-mutlich durch Td-vermittelte
Reduktion von regulatorischen Disulfidbrücken in einem
Aktivatorprotein durch eine Protein-Disulfidisomerase die Bindung
dieses Proteins an mRNA oder auch Transkriptionsfaktoren beeinflußt (Danon & Mayfield
1994, Kim & Mayfield 1997). Als Redoxsensor fungieren vermutlich
Elektronenüberträger des linearen Elektronentransportes, die abhängig
von ihrem Redoxzustand phosphoryliert werden und dadurch nachfolgend
die Phosphorylierung bzw. Dephosphorylierung von DNA-Bindeproteinen
bewirken, deren Phosphorylierungsstatus die Transkriptionsrate von
Genen festlegt (Allen 1993a-c). Neben den Signalen, die über den
Redoxstatus von PQ vermittelt werden (Escoubas et al. 1995), gibt es
Hinweise, daß auch die Expression von kernkodierten Genen z.B. über
die Akkumulation von H2O2 oder GSH reguliert wird (Schreck et al. 1991,
Karpinski et al. 1997).
Neben diesen die Expression von Enzymen beeinflussenden Änderungen im
Redoxstatus werden immer mehr chloroplastidäre und auch im Cytosol und
in den Mitochondrien lokalisierte Enzyme identifiziert, die über einen
Redox-Wechsel reguliert werden.
So wird die ADP-Glucose-Pyrophosphorylase, das Schlüsselenzym der
Stärkesynthese, in der Gegenwart von ADP-Glucose reduktiv aktiviert (Fu et al. 1998,
Ballicora et al. 2000). Die regulative Disulfidbrücke ist bei diesem
Enzym wohl zwischen den beiden kleinen Untereinheiten lokalisiert.
Auch die größere Isoform der RubisCO-Aktivase wird bei hohen
ATP/ADP-Verhältnissen spezifisch durch Td f reduktiv aktiviert (Zhang & Portis
1999). Die beiden an diesem Redoxwechsel beteiligten Cysteine wurden
identifiziert. Ein weiteres Zielenzym ist die plastidäre
Acetyl-CoA-Carboxylase (Sasaki et al. 1997, Hunter & Ohlrogge 1998).
Eine Aktivierung dieses Enzyms findet auch durch die Vorinkubation mit
Acetyl-CoA statt, so daß die Fettsäuresynthese sowohl mit dem
lichtgetriebenen Elektronenfluß als auch mit dem Metabolismus
verbunden ist. Im Cytosol scheint eine Calmodulin-abhängige NAD-Kinase
ebenfalls auf einen Redox-Wechsel zu reagieren, da eine Inaktivierung
des Enzyms aufgrund von oxidativem Streß durch Zugabe von reduziertem
DTT rückgängig gemacht werden kann (Delumeau et al. 2000). Ein
Elektronentransfer wird dann vermutlich von NADPH über die
NADP-Td-Reduktase und Td h vermittelt. Ein Wechsel im cytosolischen
Redoxstatus kann so mit anderen Signaltransduktions-Systemen verbunden
werden. Eine Inaktivierung der Hydrogenase aus der Grünalge
Scenedesmus obliquus durch Td f wurde ebenfalls beschrieben (Wünschiers
et al. 1999). Dieses kann physiologisch relevant sein, da eine H2O2-Produktion
während der Photosynthese eine starke Konkurrenz um die Elektronen
darstellt. In den Mitochrondrien werden der
2-Oxosäure-Dehydrogenase-Komplex (Bunik et al. 1997, 1999) und die
alternative Oxidase ebenfalls durch Redox-modifikation reguliert. Wie
es auch bei den meisten anderen Enzymen der Fall ist, ist sowohl die
Reduktion des Enzyms als auch ein Wechselspiel mit Metaboliten (hier:
Pyruvat) erforderlich, um das Enzym in die aktive Form zu überführen.
1.4 Fragestellungen
Aus den im ersten Teil der Einleitung dargestellten Befunden zu den
verschiedenen Regulationsmechanismen im Chloroplasten, durch die die
Pflanze befähigt ist, über eine weite Spanne auf verschiedenste
Faktoren zu reagieren, wird deutlich, daß zu den unterschiedlichen
Teilsequenzen detaillierte Ergebnisse vorliegen. Diese Prinzipien, die
häufig eine Kombination aus reduktiver Aktivierung und
Metaboliteffekten sind, wurden intensiv an isolierten Enzymen
studiert. Untersuchungen liegen auch zu den einzelnen Reaktionen im
Chloroplasten vor, während umfassende Daten zur in vivo-Regulation der
Photosynthese kaum erhoben wurden. Vornehmlich die Wechselwirkungen
zwischen dem photosynthetischen Elektronenfluß und den
nachgeschalteten Reaktionen im Stroma der Chloroplasten sind wenig
untersucht. Dies ist allerdings von großer Bedeutung, da bei
sättigendem Licht aufgrund des ständigen Überangebots an Elektronen,
die nicht mehr für CO2-Assimilation und Photorespiration genutzt
werden können, sowohl die Elektronentransportrate als auch die
Aktivität von stromalen Enzymen an diese jeweils neuen Situationen
angepaßt werden müssen. Neben den Metabolitspiegeln sind dann auch die
aktuellen Verhältnisse von NADPH/NADP und ATP/ADP betroffen. All diese
Faktoren beeinflussen in hohem Maße die stromalen Enzymreaktionen und
stellen eine Verknüpfung zwischen Elektronentransport und
verbrauchenden Reaktionen dar. Daraus leiten sich folgende konkrete
Fragestellungen ab, die im Rahmen dieser Arbeit beantwortet werden
sollen:
 Wie wirken sich Änderungen im Elektronenangebot, z.B. durch
Einstrahlen verschiede­ner Lichtintensitäten oder Umlenken des
Elektronenflusses durch zusätzli­che Elektronenak­zeptoren wie
Oxalacetat, Methylviologen oder Nitrit auf den Kohlen­stoff-Fluß durch
den Calvin-Zyklus aus?
 Welche Regulationsmechanismen, wie z.B. Einstellung der Aktivitäten
von Schlüsselenzy­men wie FBPase, PRK und NAD(P)-GAPDH über einen
veränderten Re­doxstatus im Chloroplasten und/oder Veränderungen im
Metabolitspiegel, liegen den Än­derungen im Elektronenangebot
zugrunde?
 Wie beeinflussen sich diese Parameter gegenseitig?
 Reagiert eines der redoxregulierten Enzyme besonders sensitiv auf
die experimentellen Veränderungen?
 Wie wirken die Änderungen im Elektronenfluß auf die Komponenten in
der Elek­tronen­transportkette zurück und wie sieht die Interaktion
zwischen dem Elektronen­transport und den Stromakomponenten aus?
 Welche Auswirkungen hat ein dauerhaft veränderter Elektronenfluß,
der durch vermin­derte Expression von zentralen Elektronenverteilern
(wie Fd I oder FTR) erzielt wird, auf die Photosynthese von
Kartoffelpflanzen?
2 Material und Methoden
2.1 Biochemikalien
Vertreiber
Produkte
AGS, Heidelberg, FRG
Taq-DNA-Polymerase, Isopropyl-Thiogalactosid
Amersham, Buchler, Braunschweig, FRG
[α-32P]-dCTP (1000 Ci/mmol), Hybond Nylonmem­branen N, „Sequenase
Version 2.0 Quick Denature Kit“
Baker, Groß-Gerau, FRG
Szintillations-Cocktail
Biometra, Göttingen, FRG
Acrylamid/Bisacrylamidlösung (30/0,8), 8% Gene-PAGE
Biomol, Hammburg, FRG
Ethidiumbromid, Leupeptin, Hepes, Mes, Pepstatin A, SDS, Tris
Bio-Rad, München, FRG
„Goat Anti-Rabbit IgG Horseradish-Peroxidase-Conjugate“,
Biozym, Oldendorf, FRG
Aerosol-resistente Filter-Pipettenspitzen
Roche, Mannheim, FRG
Aldolase, ATP, Desoxynukleosid-Triphosphate, DHAP, DNase I, FBP, G6P,
GDH, LDH, NAD-GAPDH, NADH, OAA, PEP, 3PGA, PGK, PK, PRI, R5P, TPI,
Triton X-100
Duchefa, Haarlem, NL
Ampicillin, MS-Salze, Kanamycin,Tetracyclin, Na-Cefotaxime (=
Claforan)
Eurogentec, Seraing, B
Oligonukleotide
Fermentas, St. Leon Rot, FRG
DNA-Polymerase I, T4-DNA-Ligase, T4-Polynukleotidkinase,
„Klenow“-Fragment, Restriktionsendonukleasen,
Fluka, Neu-Ulm, FRG
Bromphenolblau
Gerbu, Gaiberg, FRG
NADPH
Gibco BRL, Eggenheim, FRG
Agarose, Bacto Trytone, Fleischextrakt, Hefeextrakt, Select Agar
LKB Pharmacia, Freiburg, FRG
NAP5-Gelfiltrations-säulen, „ReadyToGo DNA-Labeling Kit“, Percoll
Merck, Darmstadt, FRG
Formaldehyd (37%), Gelatine
Millipore/Waters, Erkrath, FRG
Whatman 3MM-Papier
Qiagen, Hilden, FRG
QIAprep-spin Kit, QIAex-II-Kit, Qiabrane-Nylonmembranen
Promega, Heidelberg, FRG
TNT® Coupled Reticulocyte Lysate System
Riedel-de-Haen, Seelze, FRG
Ca(NO3), DMSO, EDTA, Ethanol, Glycerin, HCL, Isopropanol, KOH, MgCl2,
MgSO4, Methanol, Na-Acetat, NaCl, NaOH, NH4Cl
Roth, Karlsruhe, FRG
BSA, Dimethylformamid, Na(SO3)2, Saccharose
Schleicher & Schuell, Dassel, FRG
Protran Nitrozellulose BA85 (0,2 µm)
Serva, Heidelberg, FRG
Ammoniumpersulfat, EGTA, Formamid, Gibberellin-
säure, Pefabloc® SC, Ponceau S, Serva Blau R/G 250, TEMED
Sigma, Taufkirchen, FRG
6-Aminocapronsäure, ATP, BAP, Benzamidin, Bestatin, EGTA, Dalton Mark
VII-L, DTTred, λ-DNA, Lysozym, Magenta-Pflan­zenboxen (6 · 6 · 8 cm3),
ß-Merkaptoethanol, NAA, PVPP, PRI, Proteaseinhibitor-Cocktail,
RNase A, Röntgenfilm Kodak X-OMAT AR, Streptomycin, Spectinomycin
Smith Kline Beecham, München, FRG
ß-Bactyl®
Stratagene, Heidelberg, FRG
Helferphage 408
Wacker, München, FRG
Silikonöl AR 200
2.2 Pflanzenmaterial und Anzuchtbedingungen
2.2.1 Anzucht von Spinat
Die Anzucht von Spinat (Spinacia oleracea L. var. US Hybrid 424)
erfolgte hydroponisch in An­lehnung an die Methode von Walker (1987)
unter kontrollierten Bedingungen in Klima­kam­mern. Hierzu wurden
Samenkörner über Nacht bei 4 °C in Leitungswasser gequollen und
da­nach in mit Nährlösung getränktem Vermikulit ausgesät. Nach voller
Entwicklung der Keimblätter (ca. 10 Tage) wurden die Keimlinge
vereinzelt. Die Stengel der einzelnen Pflan­zen wurden mit
Schaumstoffringen umhüllt und je zehn Pflanzen wurden auf einen mit
Nähr­lösung gefüllten An­zuchtkasten (12,5 l Volumen) aufgesetzt. Nach
14 Tagen wurden je fünf Pflanzen in größe­ren Abständen auf neue
Kästen umgesetzt. Zur Belüftung der Nährlö­sung wurden Aquariumpum­pen
eingesetzt. Die Lösung wurde nach jeweils zwei Wochen vollständig
ausgetauscht.
Anzuchtbedingungen:
Lichtphase: 9 h; Temperatur: 20 °C; relative Luftfeuchte: 60%
Dunkelphase: 15 h; Temperatur: 15 °C; relative Luftfeuchte: 70%
Lichtintensität: 200-250 µE (in Pflanzenhöhe)
Die Nährlösung setzte sich wie folgt zusammen (je 25 l):
6 mM KNO3, 1 M Stammlösung
4 mM Ca(NO3)2, 1 M Stammlösung
4 mM MgCl2, 1 M Stammlösung
2 mM MgSO4, 1 M Stammlösung
1 mM KH2PO4/K2HPO4, pH 8.0
1 mM Na/Fe-EDTA (16.99 g/l NaEDTA + 21.6 g/l FeCl3)
25 ml Spurenelemente-Lösung:
2,86 g/l H3BO3
1,48 g/l MnCl2  2 H2O
0,22 g/l ZnSO4  7 H2O
0,08 g/l CuSO4  5 H2O
0,029 g/l NaMoO4
2.2.2 Anzucht von Kartoffelpflanzen
2.2.2.1 Sterile Kultivierung von Kartoffelpflanzen in der Klimakammer
Die Anzucht von sterilen Wildtyp-Kartoffelpflanzen (Solanum tuberosum
L., var. Desirée) und transgenen Pflanzen erfolgte in Magentaboxen auf
1,6-MS-Medium (mit 8 g Agar/l) nach Murashige & Skoog (1962). Die
Zusätze an Vitaminen, Hormonen und Antibiotika sind in Ka­pitel 2.30
aufgeführt. Nach einer Wachstumsdauer von ca. vier Wochen wurden
Kopfsteck­linge in frisches Medium umgesetzt.
Die Anzuchtbedingungen waren:
Lichtphase: 16 h; Temperatur: 24 C; relative Luftfeuchte in der
Kammer: 60%
Dunkelphase: 8 h; Temperatur: 20 C; relative Luftfeuchte in der
Kammer: 60%
Lichtintensität: ca. 70 µE (in Pflanzenhöhe, in den Boxen)
1,6-MS-Medium: 4,4 g/l MS-Salze + Vitamine
1,0 g/l MES
16,0 g/l Glucose
pH 5,7 (KOH)
2.2.2.2 Anzucht von Kartoffelpflanzen in Klimakammer und Gewächshaus
Für die primäre Selektion von transgenen Linien wurden Pflanzen aus
Gewebekultur in Erde ge­setzt und im Gewächshaus unter folgenden
Bedingungen angezogen:
Lichtphase: 13 h; Temperatur: 20 °C; relative Luftfeuchte: 60%
Dunkelphase: 11 h Temperatur: 16 °C; relative Luftfeuchte: 60%
Lichtintensität: ca. 70 µE (in Pflanzenhöhe)
Die Topfgröße betrug 17 cm im Durchmesser (1,3 l). Nach Beenden des
Lebenszyklus wur­den die Knollen geerntet und bei 10-12 °C in einem
Kühlschrank gelagert. Weiterführende Unter­suchun­gen erfolgten an
ausgewählten transgenen Kartoffelpflanzen und Wildtyp-Pflanzen in
Erde, die aus Knollen gezogen und unter den nachfolgend aufgeführten
kontrollierten Bedin­gungen in Klimakammern kultiviert wurden:
Lichtphase: 16 h / Temperatur: 22 °C; relative Luftfeuchte: 75%
Dunkelphase: 8 h; Temperatur: 18 °C; relative Luftfeuchte: 75%
Lichtintensität: 400-700 µE (in Pflanzenhöhe)
Zusammensetzung der Anzuchterde:
35% Kompost, 35% Torf, 10% Sand, 10% Bimskies, 10% Lehm. Auf 1 m3 Erde
wurden weiterhin je 1 kg Hornspäne, 1 kg kohlensaurer Kalk, 1 kg
PoliCrisal (14% N, 14% K2O, 10% P2O5, 0,7% MgO, 0,1% Mn, 0,052% B,
0,041% Cu, 0,023% Zn, 0,0037% Mo, 0,0001% Co) zugegeben.
2.3 Isolierung intakter Chloroplasten aus Spinat
Zur Reduktion der transitorischen Stärke wurden die Spinatpflanzen vor
der Isolierung dunkel gehalten und, wenn nötig, bis zu 20 Stunden mit
einem schwarzen Tuch abgedeckt. Für die Isolie­rung wurden nur
Blattspreiten mit abgerundetem Blattgrund verwendet (vier Folgeblätter
nach den Keimblättern). Alle Schritte der Isolierung wurden auf Eis
bzw. in vorgekühlten Ge­fäßen zügig durchgeführt.
Sechs bis neun frisch geerntete Blätter (Frischgewicht 15-20g) wurden
für 30 Minuten in Eiswas­ser mit einem Diaprojektor (Lichtstärke ca.
300 µE) vorbelichtet. Dann wurden die großen Blattadern mit einem
scharfen Messer entfernt, die Blätter in ca. 0,5 · 0,5 cm2 große
Stücke geschnitten und in 300 ml eiskaltem Medium A gesammelt. Der
Aufschluß erfolgte für dreimal drei Sekunden mit dem Ultraturrax (IKA,
Staufen i. Br.) bei höchster Drehzahl. Das Homoge­nat wurde durch acht
Lagen Mull und eine Lage Miracloth gegeben, vorsichtig ausgedrückt und
auf sechs Zentrifugen­röhrchen verteilt. Die Zentrifugation erfolgte
für 45 Sekunden mit 2000 g bei 4 °C (4000 Upm in der Sorvall RC5B,
Rotor SS34; DuPont, Bad Homburg). Die Überstände wurden verworfen, und
die Pellets durch vorsichtiges Spülen mit Plastikpasteur­pipetten in
je 0,5 ml Medium A auf Eis resuspendiert. In zwei weitere
Zentrifugenröhrchen wurden je 10 ml Medium A + P gegeben, und je drei
der Resuspendate vorsichtig und ohne zu vermischen aufgetragen. Um
einen sich aufbau­enden Gradienten zu erhalten, wurde bei der
anschließen­den Zentrifugation in einem „Swing-out“-Rotor bei 4 °C die
Zentrifuge konstant innerhalb einer Minute auf 2600 g (4000 Upm in der
Sorvall RC5B, Rotor HB4) beschleunigt. Die Zentrifugationszeit betrug
fünf Minuten und die Zentrifuge lief dann ungebremst aus. Der
Überstand wurde verworfen, das Pellet mit 2 ml Medium B überspült und
das Medium über dem Pellet wurde wieder dekantiert. Die Aufnahme des
Pellets erfolgte in 2 ml Medium B und das Resuspendat wurde in einem
neuen Zentrifugenröhrchen gesammelt. Nach Zugabe von 25 ml Medium B
wurde für eine Minute mit 2000 g bei 4 °C (3500 Upm in der Sorvall
RC5B, Rotor HB4) zentrifugiert. Nach Überspülen des Pellets mit Medium
B, wurde es in möglichst wenig Me­dium B (0,5-1 ml) aufgenommen. Die
Aufbewahrung der Chloroplastensuspension erfolgte dunkel und auf Eis.
Die verwendeten Medien bestanden aus folgenden Komponenten:
Medium A: 340 mM Betain
20 mM MES
5 mM MgCl2
4 mM Na-Ascorbat
2 mM EDTA (Dinatriumsalz)
0.2% BSA, entfettet
pH 6.3 (KOH)
Medium A + P: 13 ml Medium A
7 ml Percoll
Medium B: 340 mM Betain
50 mM Hepes
2 mM EDTA (Dinatriumsalz)
1 mM MgCl2
1 mM Mncl2
0.2% BSA, entfettet
pH 7.6 (KOH)
2.3.1 Bestimmung des Intaktheitsgrades isolierter Chloroplasten
Der prozentuale Anteil an intakten Chloroplasten jeder einzelnen
Präparation wurde nach der Methode von Lilley et al. (1975) bestimmt.
Dabei wird als Grundlage ausgenutzt, daß Ferri­cya­nid als
Elektronenakzeptor des PS I für die Chloroplasten-Hüllmembran
impermeabel ist und so­mit die meßbare Ferricyanid-abhängige O2-Produktion
nur an freiliegenden Thylakoid­vesikeln stattfindet.
Für die Bestimmung wurden zunächst Chloroplasten in Medium B (50
µg/ml) im Meßzylin­der der Sauerstoffelektrode mit einer
Lichtintensität von 700 µE belichtet, bis eine konstante O2-Produk­tionsrate
erreicht war (ca. 4 min). Danach erfolgte die Zugabe von 10 mM NH4Cl
und 2,5 mM Ferricyanid. Die Änderung der O2-Produktionsrate entspricht
dem Anteil an nicht-intakten Plast­iden in der jeweiligen
Chloroplastensuspension. Um die maximal erreich­bare Rate zu
ermitteln, wurden in einem zweiten Ansatz Chloroplasten der gleichen
Konzen­tration osmotisch geschockt, indem die Plastiden in 495 µl
Milli Q-Wasser eine Minute lang gerührt wurden. Nach Zugabe von 500 µl
doppelt-konzentriertem Medium B und anschlie­ßender Belichtung
erfolgte die Zugabe von Ferricyanid und NH4Cl. Die nun einsetzende
Rate ent­spricht einem Intaktheitsgrad von 0%. Sämtliche Messungen
wurden an Chloroplasten durch­geführt, die einen Intaktheitsgrad von
min­destens 90% aufwiesen.
Für den Intaktheitsgrad einer Chloroplastensuspension ergibt sich
folgende Beziehung:
(
)
1 - · 100 = % Intaktheit
O2-Produktionsrate der intakten Chloroplasten
O2-Produktionsrate der geschockten Chloroplasten
2.3.2 Polarographische Messung der CO2-abhängigen O2-Produktionsrate
Sämtliche Versuche zur Bestimmung der CO2-abhängigen O2-Produktionsrate
von Chloro­plasten wurden mittels einer Sauerstoffelektrode
(Hansatech, Kings Lynn) durchgeführt. Die Eichung der Elektrode wurde
nach der Methode von Walker (1987) durchgeführt, indem eine
Spatelspitze Natriumdithionit zu O2-gesättigtem Milli Q-Wasser gegeben
wurde. Bei 15 °C entspricht die Diffe­renz zwischen den beiden über
einen Schreiber aufgezeichneten Linien (0%- bzw. 100% O2-Gehalt) einem
O2-Gehalt von 0,305 µmol · ml-1. Änderungen in der Rate der O2-Produktion
wur­den über einen Differentiator direkt registriert. Die
standardmä­ßige Inkubation der Plastiden (45-55 µg/ml) erfolgte im
Meßzylinder der Elektrode bei 15 °C in Medium B (entgast auf einen O2-Gehalt
von ca. 30%), dem folgende Komponenten zuge­setzt wurden:
Standardinkubationsmedium:
Medium B mit 0,2 mM KH2PO4
5 mM NaHCO3
500 U/ml Katalase
Wie unter den jeweiligen Versuchsbedingungen vermerkt, wurde das
Standardinkubationsme­dium zusätzlich mit 0,2 oder 2 mM Nitrit, 2 oder
4 µM Methylviologen, 1,8 mM KH2PO4, 2,5 mM PGA plus 0,2 mM ATP, 2,5 mM
DHAP oder 5 µM Tentoxin versetzt.
Vor Belichtung der Suspension mit den jeweils gewählten
Lichtintensitäten (10-1300 µE, wei­ßes Licht) über einen Lichtleiter
wurden die Chloroplasten zwei Minuten lang im Dun­keln vorinku­biert.
2.3.3 Bestimmung der CO2-Fixierungsrate über den Einbau von [14C]-NaHCO3
Für die Bestimmung der Rate der CO2-Fixierung war es notwendig, die [14C]NaHCO3-Stammlö­sung
(1 mCi) zu reinigen. Hierzu wurde zunächst die Spitze eines 400 µl
Mikrore­aktionsgefäßes mittels Vakuumfett im oberen Bereich eines 2
ml-Eppendorf-Reaktionsgefä­ßes eingeklebt und mit 100 µl 1 N KOH
befüllt. Nach Zugabe von 50 µl der ungereinigten [14C]NaHCO3-Stammlösung
auf den Boden des 2 ml-Reaktionsgefäßes wurde ein 10 µl-Trop­fen einer
10 N HCl-Lösung an den Rand desselben pipettiert und das
Reaktionsgefäß geschlos­sen. Durch vorsichtiges Aufstoßen erfolgte die
Vereinigung des HCl-Tropfens mit der [14C]NaHCO3-Lösung, wodurch der
größte Anteil des CO2 nach 12-stündiger Inkubation bei Raumtemperatur
aus der ungereinigten Lösung ausgetrieben und in die KOH-Lösung
überführt wird. Anschlie­ßend wurde die [14C]-markierte
Bicarbonat-Lösung durch Zugabe von unmar­kiertem NaHCO3 auf eine
Konzentration von 0,25 M und eine spezifische Aktivität von 500
dpm/nmol eingestellt.
Die Probennahme zur Bestimmung der Gesamt-CO2-Fixierung erfolgte aus
dem Standardinku­ba­tionsmedium (s. Kap. 2.6). Durch intensives
Entgasen mittels Wasserstrahlpumpe und an­schließendes Begasen mit
durch 10 N KOH geleitetem N2 wurde das vorhandene CO2 weitest­gehend
aus dem verwendeten Medium B entfernt. Vor Zugabe der Chloroplasten
wurde zur Bestimmung des Nullwertes ein Aliquot von 10 µl aus dem
Inkubationsmedium entnom­men und zu 400 µl 10 N KOH in
5 ml-Szintillationsgefäße (Baker, Deventer, NL) gegeben. Diese
Suspension wurde nach Abschluß der Probennahme mit 4 ml Szintillator
(LSC Cock­tail Hydroluma, Baker, Deventer, NL) versetzt und die
Radioaktivität in einem Szintillationszähler (Packard TriCarb 2500 TR,
Pa­ckard, Canberra, A) eine Minute lang gemessen.
Nach Zugabe der Chloroplastensuspension erfolgte eine zweiminütige
Dunkeladaptation (vgl. Kap. 2.3.2). Als Blindwert wurde kurz vor Ende
der Dunkelphase ein Aliquot entnommen und wie unten be­schrieben
extrahiert. Anschließend wurden die Ansätze, wie jeweils vermerkt, mit
variierten Lichtintensitäten über einen Diaprojektor belichtet und
nach Erreichen des „steady state“ (4 min) 100 µl Aliquots entnommen.
Diese wurden in vorbereitete Szintillationsgefäße mit 400 µl 5 N HCl
pipettiert und über Nacht unter einem Luftstrom getrocknet. Die
Auf­nahme der eingeengten Proben erfolgte, indem je 200 µl 0,1 N KOH
zugegeben und gut mit den Proben durchmischt wurden. Die fixierte
Radioaktivität wurde in einem Szintillationszäh­ler je eine Minute
lang bestimmt. Die Berechnung der CO2-Fixierungsrate erfolgte anhand
der spezifischen Aktivität der verwendeten [14C]NaHCO3-Stammlösung,
dem Zählergebnis der einzelnen Proben, der spezifischen Aktivität und
dem Chlorophyllgehalt der einzelnen An­sätze.
2.4 Gaswechselmessungen an Kartoffelpflanzen
Die Messungen wurden mit dem CO2/H2O-Gaswechselanalysator LCA-4 (ADC,
Hoddesdon, England) durchgeführt. Durch die Kopplung des
Gaswechselmeßgerätes über Photoverschlüsse an ein
pulsamplitudenmoduliertes Chlorophyllfluoreszenz-Detektionssystem
(PAM) konnten parallel zum Gaswechsel Fernrotsignale und
Chlorophyllfluoreszenz-Parameter bestimmt wer­den (s. Kap. 2.5.2).
Sämtliche Messungen erfolgten unter ambienten CO2- und O2-Gehalten im
Meßgas (380 ppm CO2; 21% O2) an der Endfieder der viert-jüngsten
Hauptfieder in einer PLC4(B)-Blattkam­mer, welche eine Fläche von 6,25
cm2 einschloß. Das Meßlicht mit Intensitäten zwischen 0 µE und 1300 µE
(ist jeweils angegeben) wurde durch eine 300 W Kaltlichtquelle
(Schott, Hochheim) auf die Blattfläche appliziert. Die Meßzeit betrug
ca. 20 Minuten pro Blatt und Pflanze, wobei jede der untersuchten
Pflanzen im Abstand von zwei Tagen ein weiteres Mal gemessen wurde.
Vor Beginn der Analysen wurden schon in der Klimakammer belichtete
Pflanzen für eine Dauer von 60 Minuten dunkeladaptiert. Die Berechnung
der verschiedenen Photosynthesepa­rameter erfolgte unter Verwendung
der geräteinternen Software.
2.5 Messung von Chlorophyllfluoreszenz und Berechnung der
Koeffizienten
Die gleichzeitige Bestimmung von verschiedenen Photosyntheseparametern
(z.B. O2-Produk­tions­rate, Photosyntheserate) und
Chlorophyllfluoreszenz erfolgte sowohl an isolierten, intak­ten
Chloro­plasten (im eigenen Institut) als auch an Blattspreiten von
transgenen und Wildtyp-Kar­toffelpflanzen (am Robert-Hill Institut,
Sheffield, UK).
2.5.1 Messung der Chlorophyllfluoreszenz an Chloroplasten
Durch einen fünfarmigen Lichtleiter wurden drei verschie­dene
Lichtqualitäten auf die in den variierten Inkubationsmedien im
Meßzylinder einer DW2A-Sauerstoffelektrode (Hansatech, Kings Lynn, UK)
befindlichen Chloroplasten appliziert:
• sättigende Lichtpulse von 800 ms Dauer mit einer Intensität von
5000 µE durch eine 150 W (Osnabrück)
• aktinisches Licht (weißes Licht) variierter Lichtintensitäten
(10 µE-1300 µE) durch eine Halogenlampe
• Puls-moduliertes Meßlicht der Wellenlänge von 650 nm zur Messung der
Chlorophyllfluoreszenz an einem PAM-Fluorimeter
Zur Messung der Grundfluoreszenz (FO), die bei vollständig oxidiertem
QA auftritt, wurden die Proben im Dunkeln in die entsprechenden
Meßgeräte gegeben. Nach Ermittlung einer stabilen Grundlinie der
Fluoreszenz wurde das Meßlicht mit einer Frequenz von 1,6 kHz
eingeschaltet (s. Abb. 3). Alle weiteren Messungen wurden bei 100 KHz
durchgeführt. Die Bestimmung der maximalen variablen Fluoreszenz (FM)
erfolgte durch Applikation eines Sättigungspulses, der QA in den
vollständig reduzierten Zustand überführt. Nach Abfall des Signals auf
den Zustand von FO wurde das aktinische Licht eingeschaltet und im
Abstand von 20 Sekunden, bei Licht­intensitäten von 300-1600 µE bzw.
von 60 Sekunden, bei Lichtintensitäten 10-150 µE, sätti­gende
Lichtpulse verabreicht.

1,6 KHz
AL
Abbildung 3: Schematische Dartstellung zur Messung der verschiedenen
Fluoreszenzparameter an isolierten, intakten Chloroplasten. ML:
Meßlicht, SP: Sättigungspuls, AL: aktinisches Licht, Fv: variable
Fluoreszenz, Fv(s): maximal mögliche Fluoreszenz von PS II, FO:
Grundfluoreszenz, FM: maximale Fluoreszenz.
Zu diesen Zeitpunkten ist eine Unterscheidung zwischen
nicht-photochemischer (qN bzw. qNP), photochemischer (qP) Löschung der
Fluoreszenz und die Berechnung der Quantenaus­beuten von PS II (II)
möglich, da die variable Fluoreszenz (Fv) durch die durchgehende Linie
wiedergegeben wird und die jeweils maximal mögliche Fluoreszenz von
PS II (FV(S)) durch die SP ermittelbar ist. Zum Zeitpunkt der
Sättigungspulse ist qP dann dem Reduktionsgrad von PS II proportional,
wobei der Großteil von qN bzw. qNP durch den pH hervorgerufen wird.
Wie bei Backhausen (1994) beschrieben, war in isolierten, belichteten
Chloroplasten etwa 90% des Protonengradienten durch Zugabe von 30 nM
Nigericin zum Inkubationsmedium aufhebbar, so daß der verbleibende
Anteil von 10% auf andere Mechanismen der Fluores­zenzlöschung, wie
z.B. qI oder qT, zurückzuführen ist. Die Berechnung der Koeffizienten
er­folgte nach Schreiber et al. (1986) und Genty et al. (1989).
photochemische Löschung der Fluoreszenz: qP =
FV(S) - FV
FV(S)
nicht-photochemische Löschung der Fluoreszenz: qN =
FM - FV(S)
FM

qNP=
FM - FV(S)
Fv(s)
Quantenwirksamkeit von PS II: II =
FV(S) - FV
F0 - FV(S)
2.5.2 Messung der Chlorophyllfluoreszenz an Blättern von
Kartoffelpflanzen
Zur Bestimmung der Chlorophyllfluoreszenz an Blättern kam eine zu
Kapitel 2.5.1 abgewan­delte Methode zur Anwendung. Die Applikation der
verschiedenen Lichtqualitäten erfolgte wie oben beschrieben durch
einen siebenarmigen Lichtleiter. Bei den am Robert Hill Institute
(University of Sheffield, UK) durchgeführten Messungen wurde für die
Applikation der sätti­genden Lichtpulse eine 300 W Kaltlichtquelle
verwendet. Zusätzlich zur Chlorophyllfluores­zenz erfolgte die
Bestimmung der totalen PS I-Signale, indem vor Beginn der Messung
fern­rotes Licht (> 700 nm) auf dunkel-adaptierte Blätter gegeben
wurde. In Abbildung 4 ist ein Beispiel für einen Experimentsverlauf
bei Schwachlicht und Starklicht schematisch dargestellt. Die Löschung
der Chlorophyllfluoreszenz und der P700-Redoxzustand (A830) wurden
parallel mit zwei PAM-Fluorimetern (Walz, Effeltrich, Germany)
aufgezeichnet. Die Quantenausbeu­ten von PS II und qP wurden wie in
Kapitel 2.5.1 beschrieben berechnet. Zur Bestimmung des transmembranen
Protonengradienten (qNP) kam die von van Kooten & Snell (1990)
publi­zierte Methode zur Anwendung (s. Kap. 2.5.1), die eine für
Messungen an Blättern exaktere Berechnung darstellt. Die
Quantenausbeuten von PS I (I) wurden aus den A830-Signalen nach der
Methode von Klughammer & Schreiber (1994) berechnet.
Quantenausbeute von PS I: I =
b
Anteil an reduziertem Akzeptor: A- = FR – a – b = c
FR
1 min

5 sec

c
P700+

b



FR


a

AL
Dunkel
FR

Dunkel
AL
100 KHz

SP

Dunkel



P700-
FV(S)

Schwachlicht
Starklicht
Abbildung 4: Schematische Darstellung zur Messung der Quantenausbeuten
von PS I mittels P700+-Absorptionsänderung bei 830 nm an Blättern von
Kartoffelpflanzen bei zwei verschiedenen Lichtintensitäten. FR:
Fernrotlicht, AL: aktinisches Licht, SP: Sättigungspuls
2.6 Massenspektroskopische Messung von O2-Produktion und O2-Aufnahme
an Kartoffelblättern
Die massenspektroskopische Analyse erfolgte in Zusammenarbeit mit K.
P. Bader (Universität Bielefeld, Lehrstuhl für Zytologie) an einem
modifizierten „Delta“-Massenspektrometer für stabile Radioisotope
(Finnigan MAT, Bremen, Germany). Detaillierte Modifikationen und die
Kalibrierung des Gerätes sind bei Bader et al. (1992) beschrieben. Für
die Messungen wurden mit einem Korkbohrer ausgestochene Blattscheiben
(Ø 2,8 cm) der jeweils angegebenen Kar­toffelpflanzen direkt auf die
gaspermeable Membran der Meßkammer plaziert und mit 2 ml Wasser
bedeckt. Anschließend wurden 5 ml [18O2] (CEA-Oris, Bureau des
Isotopes Stables, Gif-sur-Yvette, France) in die Gasphase über der
Probe injiziert und die Äquilibierung mit der Flüssigkeit abgewartet
(10 min). Die Signale der Massen 32[16O2] und 36[18O2] wurden
gleich­zeitig und kontinuierlich verfolgt. Nachdem das
Dunkel-Gleichwicht erreicht war, wurden die Blattscheiben mit einem
Diaprojektor mit 400 µE belichtet. Der Sauerstoffgasaustausch wurde
über die Auf­zeichnung der 16O2-Entwicklung und der 18O2-Aufnahme
mittels eines Drei-Kanal-Schreibers nach der Methode von Bader & Röben
(1995) ermittelt.
2.7 Probenaufarbeitung zur Enzymaktivitäts- und Metabolitanalyse
2.7.1 Probennahme zur Bestimmung von Enzymkapazitäten und
Enzymaktivierungs- zu­ständen in Blättern
Für die Messung von Enzymkapazitäten und Aktivierungszuständen in
Kartoffelblättern wur­den mit Hilfe eines Korkbohrers ( 0,9 cm) je
sechs Blattstücke aus der Endfieder der viert­jüngsten Blattspreite
entlang der Mittelrippe ausgestochen. Diese wurden in ein
Eppendorf-Reaktionsgefäß überführt und sofort in flüssigem Stickstoff
(-193 °C) eingefroren. Die Probe wurde direkt im Reaktionsgefäß in
flüssigem N2 unter Zugabe einer Spatelspitze PVPP gemör­sert. Die
Extraktion der löslichen Zellkomponenten erfolgte nach Scheibe & Stitt
(1988) durch Homogenisieren des Pulvers in 300 µl Extraktionsmedium I.
Zur Chlorophyllbestimmung (s. Kap. 2.11) wurde ein Aliquot (40 µl)
entnommen. Anschlie­ßend wurden die unlöslichen Zellkomponenten durch
Zentrifugation bei 14000 rpm für eine Minute bei 4 °C sedimentiert.
Die Ermittlung von Enzymaktivitäten (s. Kap. 2.8) und Protein­gehalten
(s. Kap. 2.11) erfolgte in direktem Anschluß aus dem Überstand des
Extraktes.
Extraktionsmedium I: 50 mM Na-Acetat, pH 6,0
100 µM Pefabloc
0,1 % (w/v) BSA
0,1 % (v/v) Triton X-100
4 mM DTTred
2.7.2 Probennahme zur Bestimmung von Enzymaktivierungszuständen in
Chlo­roplasten
Für die Messung der Aktivierungszustände der stromalen Enzyme
(NAD(P)-GAPDH, FBPase, PRK, NADP-MDH) wurden Chloroplasten
(45-55 µg Chlorophyll/ml) unter den jeweils ange­gebenen Inkubations-
und Lichtbedingungen in den Meßzylinder der Sauerstoffelektrode
ge­geben (s. Kap. 2.3.2). Die Extraktion der Enzyme erfolgte, indem zu
bestimmten Zeitpunkten Aliquots von je 50 µl unter konstanter
Belichtung und Stickstoffbegasung in mit 250 µl ent­gastem
Extraktionsmedium II befüllte Eppendorf-Reaktionsgefäße überführt
wurden. Die Pro­ben wurden kurz auf dem Vortex homogenisiert und bis
zur weiteren Verwendung in flüssigem N2 gelagert.
Extraktionsmedium II: 4 mM Na-EDTA
0,05% Triton X-100 (v/v)
pH 7,8 (KOH)
2.7.3 Anreicherung von Metaboliten mittels Silikonölzentrifugation
Die Analyse stromaler Metabolitgehalte (3PGA, GAP, DHAP, FBP) in
isolierten Spinat-Chlo­roplasten erfolgte in Anlehnung an die Methode
von Heldt (1980) über die Abtrennung der Chloroplasten vom umgebenden
Medium mittels Saccharose-Silikonöl-Dichtegradienten-Zentrifu­gation.
Dazu wurden 50 µl Extraktionsmedium III in 400 µl
Polypropylen-Mikroreak­tionsgefäße (Sarstedt, Langenhagen, FRG)
pipettiert, nach einem kurzen Zentrifugationsschritt mit 50 µl
Sili­konöl AR 200 (Wacker, München, FRG) überschichtet, nochmals kurz
zentrifu­giert und bis zum Gebrauch auf Eis gelagert. Da die Gehalte
an DHAP und FBP im Chloro­plastenstroma sehr ge­ring sind, wurden je
sechs Gradienten für die Erstellung eines Daten­punktes verwendet. Die
Pro­bennahme erfolgte, indem je 200 µl der unter den angegebenen
Bedingungen inkubierten Chloroplastensuspension (s. Kap. 2.3.2) unter
konstanter Belichtung auf die Gradienten pipettiert und 15 Sekunden in
einer Tischzentrifuge mit Horizontalrotor (Microfuge, Beckman,
München) zentrifugiert wurden. Die Belichtung während der
Zentrifu­gation wurde durch einen über der Zentrifuge angebrachten
Diaprojektor gewährleistet. Bis zur Messung wurden die Gradienten in N2
gelagert (maximal zwei Wochen).
Extraktionsmedium III: 700 mM Saccharose
1 mM Na-EDTA
8% (v/v) Perchlorsäure
0,025% (v/v) Triton X-100
2.8 Bestimmung von Enzymkapazitäten und Enzymaktivierungszuständen
Enzymaktivierungszustände (in vivo-Enzymaktivitäten) der
chloroplastidären NADP-MDH, FBPase, NAD(P)-GAPDH und PRK wurden in
Chloroplasten gemessen, die unter verschiede­nen Bedingungen inkubiert
worden waren (s. Kap. 2.3.2). Für die Berechnung des prozentua­len
Anteils an aktivem Enzym erfolgte, nach Aufbrechen der Chloroplasten
durch Einfrieren in flüssigem Stickstoff, eine in vitro-Aktivierung
der Enzyme mit reduziertem DTT. Dadurch wird die maximal erreichbare
Aktivität des jeweiligen Enzyms bestimmt (= 100%). Diese in vitro-Aktivierung
wurde ebenfalls mit NADP-MDH in Blattextrakten von mit dem
Fd I-cDNA-Klon transformierten und Wildtyp-Kartoffelpflanzen
durchgeführt. Hier diente die re­duktive Aktivierung der maximal in
den Proben meßbaren Aktivität, d.h. der Bestimmung der Kapazitäten,
dieser Proteine.
Um einen Einfluß von O2 auf die Aktivitäten der redoxmodulierten
Enzyme zu vermeiden, wur­den sämtliche verwendete Lösungen entgast und
kontinuierlich mit Stickstoff begast. Aliquots von in flüssigem
Stickstoff gelagerten Proben wurden unmittelbar nach dem Auf­tauen in
mit Stickstoff überschichtete „Aktivitätsansätze“ überführt; die
Küvetten wurden mit Para­film ver­schlossen. Die reduktiven
Aktivierungen wurden ebenfalls unter Stickstoffatmosphäre bei
Raumtemperatur durchgeführt. Zu verschiedenen Zeitpunkten (20, 30, 40
min) wurden Aliquots zur Bestimmung der Maximalaktivität entnommen.
Die Messung der Enzymaktivitä­ten erfolgte spektralphotometrisch an
einem Eppendorf 1011-Photometer bei 25 °C, wobei die
Extinktionszunahme bzw. -abnahme von NAD(P)H/NAD(H) bei 334 nm
mindestens fünf Minu­ten lang verfolgt wurde.
2.8.1 Bestimmung von plastidärer NADP-MDH
Die Ermittlung von NADP-MDH-Kapazitäten und Aktivierungszuständen des
Enzyms in Blattextrakten (s. Kap. 2.7.1) bzw. Chloroplasten
(s. Kap. 2.7.2) erfolgte in Anlehnung an die Methode von Scheibe et al. (1986).
Zur Bestimmung von Kapazitäten und dem Anteil an akti­vem Enzym in den
Proben wurde vor Messung der Aktivität in einem Aliquot die maximale
Aktivierung des Enzyms (Kapazität) durch 20-minütige Inkubation mit
DTTred induziert.
NADP-MDH-Aktivierungsansatz (200 µl):
0,1% BSA
100 mM Tris-HCl, pH 8.0
20 µl Chloroplastenstammlösung (7 mg/ml)
Start der Aktivierung: 50 mM DTTred (1 M Stammlösung in 1 M Tris/HCl,
pH 9.0)
NADP-MDH-Aktivitätstest (1 ml):
0,01% (w/v) BSA
100 mM Tris/HCl, pH 8.0
0,2 mM NADPH
20 µl/200 µl Aktivierungsansatz/Chloroplastenprobe
Start der Reaktion: 1 mM Oxalacetat
2.8.2 Bestimmung von plastidärer FBPase
Die Messung von Enzymkapazitäten in Chloroplasten
(Chlorplastenstammlösung) und En­zymakti­vierungszuständen in den
extrahierten Chloroplastenproben (s. Kap. 2.3.2) erfolgte nach der
Methode von Zimmermann et al. (1976), modifiziert nach Holtgrefe
(1993). Zur maximalen Aktivierung der FBPase wurde wiederum eine
20-minütige Inkubation der Extrakte in Gegenwart von DTTred
durchgeführt.
FBPase-Aktivierungsansatz (250 µl):
100 mM Bicin-KOH, pH 8,0
10 mM Ca(NO3)2
5 mM FBP
25 µl/40 µl Chloroplastenstammlösung
Start der Aktivierung: 50 mM DTTred (1 M Stammlösung in 1 M Bicin-KOH,
pH 9,0)
FBPase-Aktivitätstest (1 ml):
50 mM Bicin-KOH, pH 8,0
2 mM/5 mM MgCl2 (2 mM: Chloroplastenprobe, 5 mM: Aktivierungsansatz)
2 U PGI
1 U G6PDH
20 µl/250 µl Aktivierungsansatz/Chloroplastenprobe
Start der Reaktion: 1 mM FBP
1 mM EGTA (nur bei Proben aus Aktivierungsansätzen)
2.8.3 Bestimmung von plastidärer NAD(P)-GAPDH
Für die Bestimmung des Aktivierungszustandes der chloroplastidären
NAD(P)-GAPDH wur­den die entsprechend vorbereiteten Proben
(s. Kap. 2.7.2) nach der Methode von Cerff (1982) mit den von Baalmann
(1993) beschriebenen Modifikationen gemessen. Die in vitro-Aktivie­rung
(15 min bei Raumtemperatur) durch DTTred diente hier ausschließlich
der Ermittlung des prozentualen Anteils an aktivem Enzym.
NAD(P)-GAPDH-Aktivierungsansatz (1 ml)
NAD(P)-GAPDH-Aktivitätstest (ohne NADPH) plus:
2 mM DTTred (1 M Stammlösung in 1 M Tris/HCl, pH 9,0)
10 µl Chloroplastenstammlösung (5 mg/ml)
Start der Aktivierung: 0,2 mM NADPH
NAD(P)-GAPDH-Aktivitätstest (1 ml)
0,1 M Tris/HCl, pH 7,8
1 mM Na-EDTA
8 mM MgSO4
4,5 mM 3PGA
2 mM ATP
0,2 mM NADPH
9 U PGK
Start der Reaktion: 40 µl Chloroplastenprobe
Vor dem Start der Reaktion erfolgte zur Bildung des Substrates
1,3bisPGA eine 15-minütige Inkubation des Testmediums bei
Raumtemperatur. Für die Berechnung des Aktivierungszu­standes wurde
nur die Anfangssteigung im Zeitraum bis zu zwei Minuten herangezogen,
da
eine weitere Aktivierung durch erhöhte Substratkonzentrationen im Test
induziert wird (Baalmann, 1993).
2.8.4 Bestimmung von PRK
PRK-Aktivierungszustände wurden in den vorbereiteten Proben
(s. Kap. 2.7.2) in Anlehnung an die Methode von Racker (1957),
modifiziert nach Faske (1992), bestimmt. Eine in vitro-Akti­vierung
durch reduziertes DTT bildete die Grundlage für die Berechnung des
prozentualen Anteils an aktivem Enzym.
PRK-Aktivierungsansatz (250 µl):
0,1 M Bicin-KOH, pH 8,0
50 µl Chloroplastenstammlösung
Start der Aktivierung: 50 mM DTTred (1 M Stammlösung in 1 M Bicin-KOH,
pH 9,0)
PRK-Aktivitätstest (1 ml):
0,1 M Bicin-KOH, pH 8,0
25 mM NaCl
10 mM MgCl2
1 mM EDTA
1 mM ATP
2 mM PEP
0,2 mM NADH
3 U PK
2 U LDH
1 U PRI
5 µl/40 µl Aktivierungsansatz/Chloroplastenprobe
Start der Reaktion: 1 mM Rib5P
2.9 Metabolitbestimmungen
2.9.1 Neutralisation der Proben zur Bestimmung von Metabolitgehalten
Die vorbereiteten Probenröhrchen (s. Kap. 2.7.3) wurden in der Ölphase
mit einem Messer durchtrennt und das restliche Öl wurde weitestgehend
mit Hilfe eines Papiertuches entfernt. Die Bestimmung in den Pellets
und Überständen erfolgte getrennt. Sofort nach dem Auftauen wurden die
Überstände zusammengegeben, mit einem Sechstel ihres Volumens an
Extrak­tionsmedium III (s. Kap. 2.7.3) versetzt und bis zur
Verarbeitung auf Eis gelagert. Zur Neutra­lisation wurden je 45 µl der
sechs Perchlorsäureextrakte vereinigt und mit dem etwa doppelten
Volumen an Neutralisierungslösung auf pH 7,4-7,7 gebracht. Nach einer
15-minütigen Inku­bation auf Eis wurde das ausgefal­lene
Kalium-Chlorat durch Zentrifugation in einer Kühlzent­rifuge
(5 min, 22500 g, 4 °C) pelletiert und Aliquots des Überstandes zur
Metabolitbestim­mung genutzt. Mit den angesäuerten Überständen der
Gradienten wurde entsprechend verfah­ren.
Neutralisierungslösung: 8 ml 3 M KHCO3
1 ml 1 M Triethanolamin-HCl, ungepuffert
ad pH 9,0 mit
0,5-1 ml 3 M K2CO3 (gesättigt)
2.9.2 Bestimmung von Triosephosphaten, FBP und 3PGA
Die Bestimmung der Metabolite DHAP, GAP, FBP, 3PGA erfolgte in
Anlehnung an die von Stitt et al. (1989) beschriebene Methode durch
gestaffelte Zugabe von Hilfsenzymen zu fol­gen­dem Aktivitätstest (1
ml):
0,1 M Tris-HCl, pH 8,1
5 mM ATP
2 mM MgCl2
0,05 mM NADH
neutralisierte Probe
1. Bestimmung von DHAP 5 U GDH
2. Bestimmung von GAP 10 U TIM
3. Bestimmung von FBP 0,5 U Aldolase
4. Bestimmung von PGA 20/10 U PGK/NAD-GAPDH
Die Abnahme der Extinktion durch Verbrauch von NADH (334 nm: 6,1 cm2 · µmol-1;
Bergmeyer 1974) wurde an einem Zweiwellenlängen-Spektralphotometer
(ZFP 22 Sigma Eppendorf, Eppendorf) bei einer Wellenlänge von 334 nm (Ref.:
405 nm) jeweils bis zum Endpunkt jeder Reaktion gemessen.
2.10 Reinigung von Fd I aus Spinat- und Kartoffelblättern
Die Isolierung von Fd I erfolgte nach der Methode von Walker (1987),
wobei für die Reini­gung des Proteins aus Kartoffelblättern einige
Änderungen eingeführt wurden. Das Homo­genisierungsmedium (20 mM KH2PO4;
pH 7,5) wurde zusätzlich mit 100 µM Pefabloc und 5% PVPP versetzt. Für
die erste Anionenaustauschchromatographie an einer DEAE-Cellulose
wurde die Säule mit 20 mM KH2PO4, pH 7,5 ohne Zusatz von NaCl
äquilibriert. Die Elution erfolgte in einem linearen Gradienten von 0
M NaCl auf 0,8 M NaCl in oben aufgeführtem Puffer mit einer Flußrate
von 2 ml · min-1. Auf die zweite Anionenaustauschchromatographie wurde
verzichtet, da das Protein unter den gewählten Bedingungen (20 mM KH2PO4;
pH 7,5) nicht an die Säulenmatrix adsorbierte. Der direkte Durchfluß,
der das angereicherte Fd I aus Kartoffel enthielt, wurde mit Hilfe
einer Druckfiltration (Ausschlußvolumen 8 kDa) auf ein Endvolumen von
4 ml gebracht. Ein Teil der Probe wurde zum sofortigen Gebrauch im
Kühl­schrank bei 4 °C gelagert, während der andere Teil bis zur
weiteren Verwendung in flüssigem Stickstoff auf­bewahrt wurde. Das in
dieser Arbeit verwendete Spinat-Fd I wurde freundlicher­weise von A.
Tegeler (ehemals Universität Osnabrück) zur Verfügung gestellt.
2.11 Bestimmung von Chlorophyll- und Proteingehalten
Die Ermittlung des Gesamt-Chlorophyllgehaltes (Chl a + b) in
Rohextrakten und Chloro­plastensuspensionen erfolgte nach der Methode
von MacKinney (1941) in 80%igem Aceton. Die Extinktion wurde bei einer
Wellenlänge von 652 nm gegen einen Blindwert bestimmt. Der
Chlorophyllgehalt wurde in jedem Inkubationsansatz der O2-Elektrode
(je 200 µl Ansatz; s. Kap. 2.3.2) oder jedem Ansatz zur Bestimmung der
Maximalaktivität der jeweiligen Enzyme gemessen (je 20 µl Probe;
s. Kap. 2.8).
Der Chlorophyllgehalt wurde wie folgt berechnet:
E652 · Verdünnung : 36 = mg Gesamt-Chlorophyll (a+b)
Zur Bestimmung der Chlorophyll a/b-Verhältnisse in Rohextrakten von
Wildtyp- und trans­genen Fd I-Kartoffelpflanzen wurde die Absorption
bei den Wellenlängen von 663,6 nm und 646,6 nm in 80%igem Aceton nach
der Methode von Porra et al. (1989) gemessen. Die Be­rechnung der
Gehalte erfolgte nach der Formel:
12,25 · A663,6 – 2,55 · A646,6 = Chlorophyll a (µg/ml)
20,31 · A646,6 – 4,91 · A663,6 = Chlorophyll b (µg/ml)
Die Bestimmung von Proteingehalten wurde nach der Methode von Bradford
(1976) mit BSA als Referenzprotein durchgeführt.
2.12 SDS-Polyacrylamid-Gelelektrophorese und „Western Blot“-Analyse
In Anlehnung an die Methode von Laemmli (1970) wurde eine
diskontinuierliche SDS-Poly­acrylamid-Gelelektrophorese (SDS-PAGE) bei
einer konstanten Stromstärke von 20-30 mA durchgeführt. Dazu wurde
entweder das BioRad-Mini Protean II-System (Plattengröße:
7,3 · 0,2 · 0,1 cm3) oder ein laboreigenes System (Plattengröße
11,5 · 11,5 · 0,15 cm3) verwen­det. Anhand eines
Proteinstandard-Gemisches (Dalton Mark VII-L) konnten die
Molekularge­wichte der Proben nach der Methode von Weber & Osborne
(1969) bestimmt werden. „Western blotting“ und „Immunoprinting“ wurden
wie bei Graeve et al. (1994) durchgeführt. Für die immunologische
Detektion von Fd I kamen polyklo­nale Antikörper gegen gereinigtes Fd
I aus Spinatblättern in einer Verdünnung von 1:1000 zur Anwendung. Der
Nachweis von FTR (A und B) erfolgte durch 1:250-1:500 verdünntes
Antiserum gegen gereinigte, rekombi­nante Spinat-FTR A- und -FTR
B-Untereinheiten. Die Probennahme und Probenaufarbeitung erfolgte wie
unter Kapitel 2.7.1 beschrieben. Für die „Western Blot“-Analyse wurde
Blattge­samtprotein mit Extraktionsmedium IV extrahiert.
Extraktionsmedium IV:
50 mM Hepes
0,1% SDS
2 mM Natriumbisulfit
0,01% BSA
1:1000 (v/v) Proteaseinhibitor-Cocktail
pH 7,0 (KOH)
2.13 Bakterienstämme und Plasmide
Die Amplifikation von DNA erfolgte in E. coli XL1-blue (Tetr, Bullock et al. 1987).
Zur Transformation von Kartoffelblättern wurde der A. tumefaciens-Stamm
C58C1:pGV2260 (Ampr, Rifr, Deblaere et al. 1985) verwendet. Der
folgenden Tabelle sind die in der vorlie­genden Arbeit verwendeten
bzw. konstruierten Plasmide zu entnehmen.
Tabelle 1: Liste der verwendeten Plasmide

Plasmid
Antibiotika-Resistenzen
Referenz
pBluescript®II SK (= pBSK)
Ampr
Stratagene, Heidelberg
pA35S-Not
Ampr
Dr. A. von Schaewen
pDE1001
Ampr, Strepr, Specr, Kanr
Deneke et al. (1990)
pA35S ftrb „sense“
Ampr, Strepr, Specr
diese Arbeit
pA35S ftrb „antisense“
Ampr, Strepr, Specr
diese Arbeit
pA35S fed1 „sense“
Ampr, Strepr, Specr
diese Arbeit
pA35S fed1 „antisense“
Ampr, Strepr, Specr
diese Arbeit
pFdA „antisense“
Ampr, Strepr, Specr, Kanr
diese Arbeit
pFdS „sense
Ampr, Strepr, Specr, Kanr
diese Arbeit
pFTRB „antisense“
Ampr, Strepr, Specr, Kanr
diese Arbeit
pFTRB „sense
Ampr, Strepr, Specr, Kanr
diese Arbeit

2.14 Bakterienkulturen und Nährmedien
Die Anzucht von E. coli XL1-blue-Zellen erfolgte aerob in YT-Medium
oder auf YT-Agar­platten (YT-Medium mit 15 g/l Select Agar) bei 37 °C
nach Sambrook et al. (1989). Die Ge­winnung kompetenter E. coli-Zellen
sowie deren Transformation wurde nach der Rubidi­um­chlorid-Methode
von Hanahan (1983) durchgeführt.
YT-Medium: 0,8% (w/v) Bacto Tryptone
0,5% (w/v) Hefeextrakt
0,25% (w/v) NaCl
pH 7,0 (NaOH)
Nach dem Autoklavieren wurden YT-Medium und Agar steril, abhängig von
den Resistenz­eigenschaften der verwendeten Zellen, mit Antibiotika in
folgenden Konzentrationen versetzt:
200 mg/l Ampicillin
10 mg/l Tetrazyklin
25 mg/l Streptomycin
50 mg/l Spectinomycin
25 mg/l Kanamycin
Zellen des A. tumefaciens-Stammes C58C1:pGV2260 wurden in YEB-Medium
bzw. auf YEB-Agar (YEB-Medium mit 15 g/l Select Agar) bei 28 °C nach
Vervliet et al. (1975) an­gezogen. Die zur Selektion verwendeten
Antibiotika sind nachfolgend aufgeführt. Die Her­stellung kompetenter
A. tumefaciens-Zellen und deren Transformation erfolgte wie bei
Höfgen & Willmitzer (1988) beschrieben.
YEB-Medium: 0,5% (w/v) Fleischextrakt
0,1% (w/v) Hefeextrakt
0,5% (w/v) Bacto Tryptone
0,5% (w/v) Saccharose
2 mM MgSO4
Antibiotika: 300 mg/l Streptomycin
100 mg/l Spectinomycin
100 mg/l Rifampicin
200 mg/l Ampicillin
2.15 Oligonukleotide
Folgende kommerziell erhältliche Oligonukleotide wurden verwendet:
„SK“- und „KS“-Oligonukleotide
Stratagene, Heidelberg
„reverse“- und „forward“-Oligonukleotide
Amersham Buchler/USB, Braunschweig
„T3“- und „T7“-Oligonukleotide
Amersham Buchler/USB, Braunschweig
In der folgenden Tabelle sind alle verwendeten speziell
synthetisierten Oligonukleotide aufge­führt:
Tabelle 2: Liste der verwendeten Oligonukleotide
Falls nicht anders vermerkt, gelten die angegebenen Positionen für die
jeweilige Sequenz aus Kartoffel. Die Sequenzen für die Oligonukleotide
PFL014, PFL015, PFL023 und PFL024 wurden von Falkenstein et al. (1994)
von Aminosäuresequenzbereichen der FTR-Untereinheiten aus Spinat (Iwadate et al. 1992)
abge­leitet. I = Inosin; N = (A/C/G/T)
Bezeichnung &
Zielsequenz
Basensequenz
PFL014 ; ftr a, Pos. 382 > (Spinat), Sinnstrang
5’-AA(A/G)CA(A/G)TA(C/T)GTNGGNTT(C/T)TGGAA(A/G)GGNAA(A/G)TA(C/T)-3’
PFL015; ftr b, Pos. 168 >, Sinnstrang
5’-AA(A/G)GA(C/T)ACNTA(C/T)TT(C/T)GTNGA(C/T)AA(A/G)TG(C/T)GT-3’
PFL023; ftr a, Pos. 524 < (Spinat), Gegenstrang
5’-(T/C)TCNGC(T/G/A)AT(C/T)TC(A/G)AA(C/T)TC(C/T)TC(C/T)TC(C/T)TT-3’
PFL024; ftr b, Pos. 443 <, Gegenstrang
5’-CAT(A/G)TTN(G/C)(A/T)NGTNAC(C/T)TCNC(T/G)(A/G/T)AT(T/C)TC(A/G)TC-3’
PFL081; ftr b, Pos. 344 >; Sinnstrang
5’-CCTCACAGTGACGTACG-3’
PFL082; ftr b, Pos. 360 <, Gegenstrang
5’-GGAGTGTCACTGCATGC-3’
SIM1; ftr a, Pos. 367 >, Sinnstrang
5’-AA(A/G)CA(A/G)TA(C/T)GTI(G/T)GI(G/T)TNTGGAA(A/G)GGN-3’
SIM2; ftr a, Pos. 510 <, Gegenstrang
5’-A(C/T)IA(A/T)(C/T)TCIAA(C/T)TCITC(C/T)TCN(C/T)(G/T)N-3’
Fdsense, fed 1, Pos. 233 >, Sinnstrang
5’-GGIATIGA(C/T)(C/T)TICCITA(C/T)(T/A)(C/G)NTG(C/T)(C/A)GNGCNGG-3’
Fdanti, fed 1, Pos. 419 <, Gegenstrang
5’-TC(T/C)TC(T/C)TT(G/A)TGIGT(T/C)TC(T/G/A)ATN(G/A)(T/C)NAC(G/A)TC-3’
PFL077; fed 1, Pos. 194 >, Sinnstrang
5’-GCCCAGATGATGTCTAC-3’
2.16 Molekularbiologische Standardmethoden
Für Restriktionsanalysen verwendete Plasmid-DNA wurde im Mini-Maßstab
durch alkalische Lyse nach der Methode von Birnboim & Doly (1979)
gereinigt. Die Isolierung von DNA zur DNA-Sequenzanalyse und zum
Einsatz in PCR-Reaktionen erfolgte mit Hilfe des „QIAprep
Spin Plasmid Kit“ nach Herstellerangaben. Die Spaltung von DNA mit
Restriktionsendo­nukleasen, Ligation von DNA mittels T4-DNA-Ligase,
Phosphorylierung von PCR-Fragmen­ten durch T4-Polynukleotidkinase,
Dephosphorylierung von linearisierten Vektoren durch BAP („bacterial
alkaline phosphatase“) sowie Auffüllreaktionen mit DNA-Polymerase I
bzw. Klenow-Fragment wurden nach Angaben der Hersteller bzw. wie bei
Sambrook et al. (1989) beschrieben durchge­führt. Die Elution von
DNA-Fragmenten aus Agarosegelen erfolgte unter Verwendung des „QIAex
II DNA Elution Kit“. Horizontale Agarosegelelektrophorese (Gelgröße:
10 · 10 · 1 cm3) erfolgte nach der Methode von Sambrook et al. (1989),
wobei PstI-geschnittene -DNA als Grö­ßenstandard diente.
Salz/Ethanol-Fällung, Phe­nol/Chloroform-Extraktion und die
photometrische Bestimmung von Nukleinsäuregehalten wässeriger Lösungen
wurden nach Sambrook et al. (1989) durchgeführt.
2.17 Isolierung von Gesamt-RNA und poly(A)+-mRNA
Zur Aufarbeitung von Gesamt-RNA aus Kartoffelblättern, -wurzeln und
-knollen wurden 5-10 g direkt nach der Ernte in flüssigem Stickstoff
schockgefrorenes Pflanzenmaterial ver­wen­det. Die Probennahme wurde
routinemäßig im Zeitraum von vier bis sechs Stunden nach Ein­setzen
der Belichtung aus der Endfieder des viertjüngsten Blattes
vorgenommen. Die Reini­gung er­folgte in Anlehnung an die Methode von
Logemann et al. (1987), modifiziert nach von Schaewen et al. (1995).
Die Tren­nung von polyadenylierter RNA (= mRNA) aus Ge­samt-RNA wurde
unter Verwendung des „Oligotex dT mRNA Kit“ nach Herstellerangaben
durchgeführt. Die mRNA-Präparationen wur­den bis zur weiteren
Verwendung als Ethanol­fällung bei -20 °C aufbewahrt.
2.18 Synthese von einzelsträngiger cDNA aus Gesamt-RNA bzw. poly(A)+-RNA
Zur Herstellung des ersten Stranges cDNA wurden 5 µg Gesamt-RNA oder
ca. 250 ng poly(A)+-mRNA und 50 ng Oligo(dT)15 mit sterilem H2Obidest
auf ein Endvolumen von 10 µl gebracht und für fünf Minuten bei 72 °C
denaturiert. Nach Abkühlen des Ansatzes auf Raum­temperatur (10 min)
wurden folgende Komponenten hinzugefügt:
200 µM dNTP-Mischung (A,C,G,T)
20 U RNasin®
200 U Reverse Transkriptase M-MLV (H- RT Superscript®)
RT Superscript Puffer
Durch die 30-minütige Inkubation des Reaktionsansatzes bei 37 °C
erfolgte die cDNA-Syn­these.
Die Reaktion wurde durch fünfminütiges Erhitzen auf 94 °C gestoppt.
Die gewonnene cDNA wurde entweder direkt als Matrize in eine
PCR-Reaktion eingesetzt oder bis zum Gebrauch bei -20 °C eingefroren.
2.19 DNA-Amplifikation mittels Polymerase-Kettenreaktion (PCR)
Durch den Einsatz verschiedener genspezifischer Oligonukleotide
(s. Kap. 2.15) wurden fed 1-, ftr a- und ftr b-cDNA-Fragmente mittels
PCR amplifiziert. Ein Standard-PCR-Ansatz (100 µl Endvo­lumen) setzte
sich wie folgt zusammen:
1-100 ng cDNA-Vorlage
0,2 mM dNTP
60 pmol je Oligonukleotid
2 U Taq-DNA-Polymerase
Reaktionspuffer
Um einen Flüssigkeitsverlust durch Verdunstung zu vermeiden, wurden
die PCR-Ansätze mit 100 µl Mineralöl überschichtet. Die Reaktionen
wurden, wie bei den einzelnen Versuchs­durch­führungen angemerkt, in
einem TRIO-Thermoblock TB1 (Biometra, Göttingen) mit folgenden
Temperaturprogrammen durchgeführt:
}
5 min 94 °C
Denaturieren 1 min 94 °C
Oligonukleotidbindung 1 min 40, 45 oder 50 °C 45 Zyklen
Strangverlängerung 2 min 72 °C
5 min 72 °C
 4 °C
2.20 Synthese von Digoxigenin-markierten DNA-Sonden mittels PCR
Für das „Screenen“ von cDNA-Expressionsbanken zur Identifizierung von
Fd I erfolgte die nicht-radioaktive Markierung eines fed 1-spezifischen
cDNA-Fragments mittels PCR. Hierzu wurden in einem Standard-PCR-Ansatz
die unmarkierten dNTPs durch eine Mischung mit Digoxigenin
(DIG)-gekoppelten dUTPs (20 µM) ersetzt. Als Matrize dienten 160 ng
über Agarosegel gereinig­te fed 1-Frag­ment-DNA, die zusammen mit den
Oligonukleotiden Fdsense und Fdanti (s. Tab. 2) in die
Markierungs-Reaktion eingesetzt wurden. Die Reinigung der
DIG-markierten Amplifikate erfolgte durch Trennung in einem 2 %-igen
Agarosegel und anschließender Gel­elution. Nach Bindung der
DIG-modifizierten Fragmente an deren Ziel-DNA können diese
immunologisch nachgewiesen werden (s. Kap. 2.22).
2.21 Synthese von radioaktiv markierten DNA-Sonden
Die Herstellung von -[32P]-dCTP-markierten DNA-Sonden wurde sowohl
mit Hilfe von PCR als auch unter Verwendung des „Ready To Go DNA
Labeling Kit“ durchgeführt. Für den Nachweis von ftr a- und ftr b-spezifischen
DNA-Sequenzen in Kartoffelblatt-cDNA-Expres­sionsbanken (s. Kap. 2.22)
erfolgte die Markierung der jeweiligen DNA-Fragmente in
PCR-Reaktio­nen. In dem Stan­dard-PCR-Ansatz wurde das unmarkierte
dCTP durch 50 µCi -[32P]-dCTP ausgetauscht und je 10 ng PCR-Produkt
zusammen mit den Oligonukleotidpaaren SIM1/SIM2 (Untereinheit FTR A)
und PFL 15/PFL24 (Untereinheit FTR B) zugegeben. Die Synthese von
radioaktiv markierten Sonden zur Analyse von RNA- bzw.
DNA-Präpara­tionen erfolgte nach der Methode von Feinberg & Vogelstein
(1983 und 1984) mittels des „Ready To Go DNA Labeling Kit“ mit 50-250
ng de­naturierter DNA als Matrize. In beiden Fällen wurden die nicht
inkorporierten Nukleotide über eine NAP 5-Gelfiltrations­säule in
TE-Puffer plus 0,5% SDS abgetrennt. Die relativen Einbauraten wurden
im Szintillations­zähler bestimmt. Fraktionen mit den höchsten
Einbauraten wurden verei­nigt und bis zur Hy­bridisierung bei -20 °C
aufbewahrt.
TE-Puffer: 10 mM Tris
1 mM EDTA
pH 7,5 (HCl)
2.22 „Screening“ einer cDNA-Bank mit DIG- und radioaktiv markierten
DNA-Sonden
Die verwendete, in -ZAP II konstruierte Kartoffelblatt-cDNA-Bank
wurde freundlicher­weise von Dr. U. Sonnewald (Gatersleben) zur
Verfügung gestellt. Die Insertion der mit NotI-EcoRI-Adaptern
versehenen cDNA-Fragmente erfolgte über die EcoRI-Schnittstelle der
„multiple cloning site“ in -ZAP II-Vektoren.
Die Analyse der Kartoffelblatt-cDNA-Bank mit Hilfe einer fed 1-spezifischen,
DIG-markierten DNA-Sonde (s. Kap. 2.21) diente der Identifizierung des
für Fd I kodierenden cDNA-Klons. Das Ausplattieren der
Phagensuspension (je 250.000 Plaques pro Platte) und die Be­handlung
der Nitrozellulose-Rundfilter erfolgte nach der von Sambrook et al.
(1989) be­schriebenen Methode. Die nachfolgende Hybridisierung der
Filter und die immunlogische Detektion mittels des „DIG DNA Labeling
and Detection Kit“ folgte den Angaben des Her­stellers. Zur
eindeuti­gen Identifi­kation von einzelnen Phagenplaques und zur
Überprüfung der Detektion wurden diese in weiteren
Hybridisierungsschritten vereinzelt.
Die Isolierung der ftr a- und ftr b-cDNA-Klone erfolgte ebenfalls aus
der oben aufgeführten Kar­toffelblatt-cDNA-Bank unter Verwendung von [35S]-dATP
markierten, ftr a- und ftr b- spezifi­schen DNA-Fragmenten
(s. Kap. 2.21). Nach Übertragung der Phagenplaques auf un­geladene
Nylon­membranrundfilter erfolgte die Denaturierung und Neutralisierung
der DNA (Sambrook et al. 1989). Nachfolgend wurde die DNA mittels
UV-Bestrahlung mit der Memb­ran quervernetzt. Zur Absättigung der
unbesetzten Bindungsstellen wurden die Membranen für zwei Stunden bei
42 °C in Hybridisierungspuffer (Church et al. 1984) inkubiert. Dann
wurden die entsprechenden Sonden für eine Hybridisierungsdauer von
20 Stunden bei 42 °C zugege­ben. Zur Entfernung von unspezifisch
gebundenen DNA-Fragmenten erfolgten danach zwei Waschschritte bei
68 °C für je zehn Minuten in dreifach konzentriertem SSC-Medium und
ein Waschschritt in zweifach konzentriertem SSC-Medium. Nach
Entwicklung der Autoradio­gramme wurden positive Klone isoliert und
die Phagen durch Inkubation in SM-Medium (über Nacht bei 4 °C) unter
Zusatz von 10% Chloroform aus dem Agar eluiert. Zur Vereinzelung und
sicheren Identifizierung der Klone wurde mit diesen in zwei weiteren
Runden nach dem oben beschriebenen Protokoll verfahren.
SSC-Medium
SM-Medium
3 M
NaCl
50 mM
Tris-HCl, pH 7,5
0,3 M
Natriumcitrat
12% (w/v)
NaCl
pH 7,0 (HCl)
4% (w/v)
MgSO4
2% (w/v)
Gelatine
2.23 In vivo-Exzision
Aufgrund der Konstruktionsweise des -ZAP II-Vektors können unter
Verwendung eines Hel­fer­phagen pBSK-Plasmide mit inserierten
cDNA-Klonen ausgeschnitten werden. Die Re­zirkulation der Plasmide und
nachfolgende Amplifikation in E. coli XL1-blue-Zellen erfolgte nach
Angaben des Herstellers (-ZAP II-Protokoll, Stratagene, Heidelberg).
2.24 DNA-Sequenzanalyse
Doppelsträngige Plasmid-DNA wurde nach der von Sanger et al. (1977)
beschriebenen Di­desoxy-Kettenabbruch-Methode unter Verwendung des
„Sequenase Version 2.0 Quick De­nature Kit“ (Amersham Buchler/USB,
Braunschweig) sequenziert. Die elektrophoretische Trennung der mit [35S]-dATP
markierten DNA-Fragmente erfolgte in 6-8%igen Harnstoff­gelen
(600 · 180 · 0,19 mm3) bei 3000 V und 55 °C. Als Oligonukleotide
wurden sowohl kommerziell erhältliche, die mit komplementären
pBSK-Plasmidsequenzen hybridisieren, als auch genspezifische
Oligo­nukleotidpaare verwendet (s. Tab. 2). Sämtliche Analysen neuer
Gen­sequenzen wurden dop­pelsträngig durchgeführt.
2.25 „Northern Blot“- und „Southern Blot“-Analysen
Der in dieser Arbeit verwendete „Southern Blot“ wurde
freundlicherweise von A. von Schaewen (Universität Münster) zur
Verfügung gestellt. Die Isolierung genomischer DNA er­folgte nach der
Methode von Dellaporta et al. (1983).
Hitzedenaturierte genomische DNA bzw. Gesamt-RNA wurde in
formaldehydhaltigen Aga­rose­gelen aufgetrennt. Die Überführung der
Nukleinsäuren auf Nylonmembranen (Hybond N, Amersham Buchler/USB,
Braunschweig) mittels Kapillartransfer und die Hybridisierung mit -[32P]-dCTP-markierten
Sonden folgte den Angaben von Sambrook et al. (1989) mit von
Church & Gilbert (1984) beschriebenem Hybridisierungspuffer. Zur
Rehybridisierung der Blots wurden die Sonden durch einstündige
Inkubation bei 68 °C in folgendem Medium ent­fernt (Sambrook et al. 1989):
50 mM Tris-HCl, pH 8,0
50% Formamid
1% SDS
2.26 In vitro-Translation
In vitro-Translation der isolierten fed 1- und ftr b-cDNA-Klone
erfolgte mittels des in vitro-Trans­lationssystems „TNT® Coupled
Reticulocyte Lysate System“ (Promega, Madison, USA) nach
Herstellerangaben. Die gekoppelte Synthese von RNA und Protein wurde
in Gegenwart von [35S]-Methionin in zellfreiem Reticulocytenlysat aus
Kaninchen durchgeführt. Nach Auf­trennung der markierten Produkte in
20%-igen SDS-Gelen wurden von den getrockneten Gelen Autoradio­gramme
hergestellt.
2.27 Konstruktion der binären Vektoren zur Über- und Unterexpression
von Fd I in Kartoffelpflanzen
Zur Erhöhung bzw. Reduktion des endogenen Gehaltes an Fd I in
Kartoffelpflanzen wurden zwei verschiedene Ansätze gewählt: Die
Unterexpression erfolgte im homologen System, d.h. durch
Transformation von Kartoffelpflanzen mit dem Kartoffel-eigenen
cDNA-Klon (diese Arbeit) in „antisense“-Orientierung. Für die
Überexpression wurde ein heterologes System gewählt, d.h. Integration
eines artfremden cDNA-Klons in „sense“-Orientierung in das
Kartof­felgenom. Dazu wurde der für Fd I kodierende cDNA-Klon aus
Spinat verwendet (freundli­cherweise von Norbert Wedel, ehemals
Universität Osnabrück, zur Verfügung gestellt).
314 bp
291 bp
EcoRI HindIII
HindIII EcoRI
fed 1 Spinat, 670 bp
fed 1 Kartoffel, 639 bp
469 bp
170 bp

NotI HindIII NotI

Pvu II [SmaI/EcoRI] HindIII HindIII [EcoRI/SmaI] Pvu II
CaMV35S OCSpA pA35S fed1 Spinat „sense“, 1745 bp
CaMV35S OCSpA pA35S fed1 Kartoffel „antisense“,
1714 bp
[SmaI/Not I] HindIII [Not I/SmaI]
RB SmaI LB
PNOS NEO 3’OCS T-DNA
T-DNA-Region des pDE1001
Abbildung 5: Klonierungsschema zur Konstruktion der binären Vektoren
pFdS und pFDA zur Über- und Unterexpression von Fd I in
Kartoffelpflanzen.
Die vollständigen cDNA-Klone, die für Blatt-Fd I kodieren, wurden in
„sense“- bzw. „antisense“-Orientie­rung zwischen den CaMV35S Promotor
und die OCS-Terminationsse­quenzen der pflanzlichen
Expres­sionskassette pA35S (805 bp) inseriert (Kartoffel: 639 bp;
Spinat: 670 bp). Die Konstrukte wurden als PvuII-Fragmente (Kartoffel:
1714 bp; Spinat: 1745 bp) isoliert und in den mit SmaI linearisierten,
binären Vektor pDE1001 kloniert. Nach Transformation der
resultierenden Plasmide (pFdA = „antisense“; pFdS = „sense“) in den
Agrobacterium tumefaciens-Stamm GV2260 erfolgte die in Kapitel 2.29
beschriebene Transformation von Kartoffelblattstückchen.
cDNA-Bereiche, die für die reifen Proteine kodieren sind farbig
markiert. RB: „right border“; LB: „left border“; NEO:
Neomycin-Phosphotransferase-Gen (Kanamycin-Resistenz) gesteu­ert durch
den Nopalin-Synthase-Promotor (PNOS); 3’OCS = OCSpA:
Octopinsynthetase-Terminations­sequenzen.
Für das „antisense“-Konstrukt wurde der nach in vivo-Exzision im
Plasmid pBluescript SK- vor­liegende Fd I-cDNA-Kartoffel-Klon (575 bp,
kodierender Bereich 432 bp) durch Restrik­tionsverdau mit NotI
inklusive Transitpeptid ausgeschnitten. Die überhängenden Enden
wur­den mittels T4-DNA-Polymerase enzymatisch aufgefüllt. Nach
Isolierung des resultieren­den 639 bp langen Fragmentes erfolgte die
„blunt end“-Ligation in die pflanzliche Ex­pressions­kassette des mit
SmaI linearisierten Vektors pA35S (Höfte et al. 1991). Dieser Vektor
enthält die für eine Expression in Pflanzenzellen notwendigen Signale
(CaMV35S-Promoter und Octopin­synthetase-Terminationssequenzen). Der
Vektor mit Insert (pA35S Kfed1 „antisense“; s. Tab. 1) wurde in E.
coli amplifiziert. Die Ori­entierung des cDNA-Klons wurde durch die
interne HindIII-Restriktionsschnittstelle festgestellt. Durch PvuII-Verdau
wurde anschlie­ßend ein 1714 bp-Fragment, das die Expressionskassette
und den fed 1-cDNA-Klon enthielt, ge­wonnen und über die SmaI-Schnittstelle
in die T-DNA-Region des binären Vektors pDE1001 (Denecke et al. 1990)
inseriert (s. Abb. 5).
E. coli XL1-blue-Zellen wurden mit die­sem Konstrukt (pFd A
„antisense“; s. Tab. 1) transfor­miert. Nach Miniplasmidisolierung
wurden Leserichtung und Größe der inserierten Fragmente durch
Restriktionsanalyse mit HindIII überprüft. Für die Transformation von
Agrobacterium tumefaciens GV2260 wurde ein Plasmid verwendet, in
welches das fed 1-Fragment in „sense“-Orientierung in Bezug auf das
Nopalinphosphotrans­ferase II-Gen inseriert war. Der Erfolg der
Agrobacterium tumefaciens-Transformation wurde wiederum durch einen
Verdau der isolier­ten Plasmid-DNA mit NcoI über­prüft.
Zur Herstellung des „sense“-Konstrukts (pFdS „sense“; s. Tab. 1) wurde
aus dem Vektor Bluescript M13+ ein 670 bp langes EcoRI-Fragment
isoliert, welches für das vollständige Präprotein von Fd I aus Spinat
kodiert (441 bp, Wedel et al. 1988). Die Enden wurden enzy­matisch
aufgefüllt und über die SmaI-Schnittstelle in den
Pflanzenexpressionsvektor pA35S inseriert. In allen folgenden
Schritten wurde wie oben für die Herstellung des
„antisense“-Kon­struktes be­schrieben verfahren.
2.28 Konstruktion der binären Vektoren zur Über- und Unterexpression
der FTR B-Untereinheit in Kartoffelpflanzen
Analog zu den Ansätzen, die für die Über- und Unterexpression von Fd I
in Kartoffelpflanzen gewählt wurden, erfolgte die Klonierung des ftr b-cDNA-Klons
aus Kartoffel (diese Ar­beit) in „antisense“-Orientierung und die des
Spinat-ftr b-Gens (Falkenstein et al. 1994) in „sense“-Orientierung in
die pflanzliche Expressionskassette des Vektors pA35S.
Für das „antisense“-Konstrukt wurde der im Vektor pBSK vorliegende
vollständige ftr b-cDNA-Klon aus Kartoffel als NotI-Fragment isoliert.
Dieses 1684 bp lange Fragment umfaßt den 5’-untranslatierten Bereich
(887 bp), den codierenden Bereich (444 bp) und den
3’-un­translatierten Bereich (353 bp) des isolierten cDNA-Klons. Die
Insertion in den Pflanzenex­pressionsvektor pA35S erfolgte über die
NotI-Schnittstelle der „multiple cloning site“. Nach Amplifikation des
erhaltenen Plasmids pA35S Kftr b „antisense“ (s. Tab. 1) in E. coli
XL1-blue-Zellen wurde die Orientierung durch Restriktion mit den
Endonukleasen BamHI und PstI verifiziert. Der ftr b-Klon in
„anti­sense“-Orientierung plus pflanzlicher Expressionskassette wurde
dann durch Partialverdau mit PvuII gewonnen und das resultierende 2759
bp-Fragment aus dem Gel isoliert. Die Ligation mit dem binären Vektor
pDE1001 erfolgte über die SmaI-Schnitt­stelle im Bereich der rechten
„border“. Größe und Orientierung des Fragments wurden so­wohl nach
Transformation und Ver­mehrung in XL1-blue-Zellen als auch nach
Transforma­tion in A. tumefaciens-Zellen durch die internen NotI- und
PstI-Schnittstellen überprüft (s. Abb. 6).
Das im Vektor pBSK konstruierte ftr b-Gen aus Spinat wurde zur
Herstellung des „sense“-Konstrukts mit ScaI und NotI ausgeschnitten.
Das isolierte 575 bp-Fragment kodiert für den 5’-untranslatierten
Bereich, das vollständige Präprotein und eine Teilsequenz des
3’-un­transla­tierten Bereiches des vorliegenden Gens (s. Abb. 5).
Nach Auffüllen der überhängen­den Enden erfolgte die Ligation mit dem
durch SmaI linearisierten Vektor pA35S. Die Orientierung wurde durch
Restriktion mit SphI überprüft und das resultierende, in
XL1-blue-Zellen amplifizierte Plasmid (pA35S Sftrb „sense“; s. Tab. 1)
mit PvuII geschnitten. Das 1650 bp lange Fragment wurde dann über SmaI
in die T-DNA-Region des pDE1001 inseriert.
Die Erzeugung transgener Pflanzen erfolgte durch Agrobacterium
tumefaciens-vermittelten Trans­fer der Plasmid-DNA in S. tuberosum-Blätter.
Hierzu wurden Transformanten benutzt, die eine Insertion der „sense“-
und „antisense“-Konstrukte in Leserichtung in Bezug auf das
No­pa­linphosphotransferase II-Gen aufwiesen.
NotI SphI ScaI NotI
ftr b Spinat, 705 bp
ftr b Kartoffel, 1684 bp
NotI BamHI PvuII PstI NotI

P vuII [SmaI/NotI] SphI ScaI [NotI/SmaI] PvuII
BamHI [SmaI/NotI] PstI PvuII BamHI [NotI/ SmaI]
Abbildung 6: Klonierungsschema zur Konstruktion der
Expressionsvektoren pA35S Sftrb „sense“ und Kftrb „antisense“ zur
Über- und Unterexpression von FTR B-Untereinhei­ten in
Kartoffelpflanzen.
Die für FTR B-Untereinheiten aus Spinat (565 bp) und Kartoffel (1685
bp) kodierenden cDNA-Klone wur­den zwischen CaMV35S-Promotor und
OCS-Terminationssequenzen in die SmaI-Schnittstelle des
Pflanzen­expres­sionsvektors pA35S kloniert. Die Expressionskassetten
(805 bp) mit den inserierten Klonen wurden als PvuII-Fragmente
(Spinat: 1650 bp, Kartoffel: 2759 bp) isoliert und mit dem SmaI-linearisierten
binären Vektor pDE1001 ligiert (vgl. Abb. 5). cDNA-Bereiche, die für
die reifen Proteine kodieren, sind farbig mar­kiert. CaMV35S:
„Cauliflower Mosaik Virus 35S“-Promotor; OCSpA:
Octopinsyntase-Terminationssequen­zen.
2.29 A. tumefaciens-vermittelte Transformation von Kartoffelblättern
und Re­generation transgener Pflanzen
Für die Transformation wurden etwa vier Wochen alten, sterilen
Blattspreiten die Mittelrippen ent­fernt und die einzelnen Blätter in
vier bis sechs Stücke geschnitten. Die Blattstücke von jeweils zehn
Blättern wurden mit der Blattunterseite nach oben auf je 10 ml
steriles 2-MS-Medium (analog zu 1,6-MS-Medium mit 20 g/l Saccharose
statt Glucose; s. Kap. 2.2.2.1) in Petrischalen gelegt. Nach Zugabe
von 50 µl der entsprechenden A. tumefaciens-Übernacht­kultur erfolgte
eine zweitägige Dunkelin­kubation bei Raumtemperatur. Anschließend
wurden die infizierten Blattstückchen in sterilem 2-MS-Medium
gewaschen und zur Kallusinduktion auf Agarplatten mit
Kallusinduktionsme­dium plus Phytohor­mone und Antibiotika
transferiert.
Kallusinduktionsmedium (CIM):
1,6-MS-Agar mit 5mg/l Naphthylessigsäure
0,1 mg/l Benzaminopurin
125 mg/l ß-Bactyl
50 mg/l Kanamycin
Zur Sproßinduktion wurden die Blattstücke nach einer Woche auf
Agarplatten mit Medium fol­gender Zusammensetzung überführt:
Sproßinduktionsmedium (SIM):
1,6-MS-Agar mit 20 µg/l Naphthylessigsäure
20 µg/l Gibberellinsäure (GA3)
2 mg/l Zeatinribose
125 mg/l ß-Bactyl
50 mg/l Kanamycin
Im Abstand von je einer Woche wurden die Blattstückchen auf neuen
SIM-Agar umgesetzt. Nach Ausbildung von Sprossen wurden diese vom
Kallus abgetrennt und in 1,6-MS-Agar, supplemen­tiert mit ß-Bactyl
(125 mg/l) und Kanamycin (500 mg/l), gesetzt. Sobald die Sprosse
bewurzelt waren, wurden Kopfstecklinge dieser regenerierten Pflanzen
erneut auf ihre Fähigkeit getestet, auf Kanamycin-haltigem Medium zu
wachsen. Kanamycin-resistente Pflan­zen wurden dann nach ca. sechs
Wochen in Erde gesetzt und bis zur Analyse, die nach einer weiteren
Wachstumszeit von vier bis sechs Wochen erfolgte, im Gewächshaus
gezogen. Als Kontroll­pflanzen wurden analog zu den Trans­formanten
Wildtyp-Kartoffelpflanzen aus Blattstückchen auf 1,6-MS-Agar
regeneriert, der kein Kanamycin enthielt.
2.30 Bioinformatische Analysen
Die Charakterisierung der in dieser Arbeit isolierten cDNA-Sequenzen
erfolgte unter Verwen­dung verschiedener Programme, die über den
„ExPASy Molecular Biology Server“ des Swiss Institute of
Bioinformatics abrufbar sind (http://www.expasy.ch).
Die Translation der Sequenzen wurde mit den Programmen „Translate“ (http://www.expasy.ch/tools/dna.html)
oder „Molecular Biology Shortcuts (MBS)-Translator“ (http://mbshortcuts.com/translator)
durchgeführt. Identitäten zwischen den isolierten Kartoffel-Sequenzen
und Sequenzen anderer Pflanzenarten wurde mit Hilfe des Progamms
„LALIGN“ (http://www.ch.embnet.org/software/LALIGN_form.html) nach dem
Algorithmus von Huang & Miller (1991) erstellt. Für multiple
Sequenzvergleiche zwischen verschiedenen Pflanzenspezies wurde das
Programm „ClustalW“ (http://www2.ebi.ac.uk/clustalw) verwen­det. Die
Identifizie­rung der Transitpeptid-Spaltstellen erfolgte mit dem
Programm „ChloroP“ (http://www.cbs.dtu.dk/services/chlorop) (Emanuelsson et al. 1999).
2.31 Darstellung der Ergebnisse
Die an isolierten Chloroplasten durchgeführten Versuche zogen sich auf
Grund der Vielzahl verschiedener Bedingungen über einen ausgedehnten
Zeitraum hin. Dabei wurde die Erfahrung gemacht, daß trotz
hydroponischer Anzucht der Spinatpflanzen in einer Klimakammer
jahres­zeitliche Schwankungen zumindest in geringem Umfang auftreten.
Die Inhomogenität im Untersuchungsmaterial kann ein Grund für die
beobachteten Streugungen schon innerhalb der Kontrollmessungen sein.
Eine weitere Ursache ist die meßtechnisch bedingte Schwankung im
Chlorophyllgehalt, der bei sämtlichen Versuchen an Chloroplasten als
Bezugsgröße verwendet wurde. Daher zeigen die dargestellten Kurven
typische Verläufe unter den einzelnen Bedin­gungen. Jedes Experiment
wurde mindestens dreimal durchgeführt, um die jeweils gemessenen
Tendenzen zu sichern.
3 Ergebnisse
Als Versuchsmaterial für die zu bearbeitenden Fragestellungen wurden
im ersten Teil dieser Arbeit isolierte intakte Spinatchloroplasten
ausgewählt. Der Zusatz von verschiedenen Elektronenakzeptoren zum
Inkubationsmedium ermöglicht dann kontrollierte Elektronenflüsse
- neben der Reduktion von Intermediaten im Calvin-Zyklus - zu anderen
verbrauchenden Prozessen zu induzieren. Der chloroplastidäre
Redoxstatus ist außerdem von der eingestrahlten Lichtintensität
abhängig. In diesem Zusammenhang sollten möglichst detaillierte
Ergebnisse zu diversen Photosyntheseparametern (qN, qP, II, O2-Freisetzungsrate),
Enzymaktivierungs-zuständen wichtiger Enzyme des Calvin-Zyklus und
Änderungen in den Intermediatspiegeln in Abhängigkeit von der
Lichtintensität erhoben werden.
In einem sensitiven System wie es die Chloroplasten darstellen, muß
gewährleistet sein, daß die Qualität aufeinanderfolgender
Präparationen vergleichbar ist. Daher wurde für jeden Versuch jeweils
die Membranintegrität mittels Ferricyanid-abhängiger O2-Freisetzungsrate
überprüft und nur Plastiden mit einer Intaktheit von >95% verwendet.
Als weiterer physiologischer Parameter wurde die CO2-abhängige O2-Entwicklung
herangezogen und die Versuche ausschließlich mit Chloroplasten
durchgeführt, die eine O2-Freisetzung von 90-100 µmol O2  mg Chl-1  h-1
aufwiesen, welche nach Erreichen des „steady state” (4 min) über einen
Zeitraum von zehn Minuten stabil blieb. Um eine Ausdünnung von
Metaboliten und Pi zu vermeiden, wurde die
Chloroplastenstammsuspension direkt nach der Isolierung auf einen
Chlorophyllgehalt von 7 mg   ml-1 eingestellt und jeweils 50 µg  ml-1
für die Versuche in die Sauerstoffelektrode eingesetzt. In Gegenwart
von 0,2 mM Pi und 5 mM NaHCO3 als CO2-Quelle wurden während der
Versuchsdauer keine Limitierungen festgestellt. Zur Vermeidung eines
zu hohen Sauerstoffpartialdruckes wurden vor Beginn der Messungen
sämtliche Lösungen durch Entgasen auf etwa 30% der Sättigung gebracht.
Am intakten Blatt sind die Elektronenflüsse nicht so einfach
manipulierbar. Über die Konstruktion von transgenen Pflanzen mit
veränderten Gehalten von Enzymen mit Elektronen-übertragender Funktion
besteht aber die Möglichkeit, ein Versuchsmaterial zu erhalten, an dem
nicht-invasiv diverse Parameter untersucht werden können. Zu diesem
Zweck wurden mittels „sense/antisense“-Technik Kartoffelpflanzen
hergestellt, in denen erhöhte oder erniedrigte Mengen der Proteine Fd
I bzw. FTR vorliegen. Die Auswahl dieser Proteine lag nahe, weil (1)
Fd als zentraler Elektronenverteiler die Elektronentransportkette an
sämtliche im Chloroplastenstroma lokalisierten verbrauchenden
Reaktionen koppelt und (2) die FTR als Teil des Fd/Td-Systems an der
Redoxmodulation von Enzymen im Chloroplastenstroma beteiligt ist (s.
Abb. 1 und 2). Um eine stabile Unterexpression der entsprechenden Gene
zu erreichen, sollte die Transformation im homologen System erfolgen,
d.h. beide bislang aus Kartoffel noch nicht bekannten cDNA-Klone
mußten zunächst isoliert werden.
3.1 Untersuchungen zu Veränderungen im Elektronenangebot und von
Meta­bolitgehalten in Chloroplasten
3.1.1 Effekt von steigenden Lichtintensitäten auf diverse
Photosyntheseparameter und den Aktivierungszustand ausgewählter
stromaler Enzyme
Um die Auswirkungen der Interaktionen zwischen dem linearen
Elektronentransport und den internen Metabolitspiegeln auf die
Aktivierungszustände von redoxmodulierten Calvin-Zyklus-Enzymen
charakterisieren zu können, wurden zunächst verschiedene
Photosyntheseparameter isolierter, intakter Chloroplasten in
Abhängigkeit von der eingestrahlten Lichtmenge unter
Kontrollbedingungen bestimmt. Dazu erfolgte in Parallelansätzen die
Belichtung der Plastidensuspension (50 µg  ml-1) mit steigenden
Lichtintensitäten von 10-700 µE im Reaktionsgefäß der
Sauerstoffelektrode in Gegenwart von sättigendem CO2 (5 mM NaHCO3) und
Phosphat (0,2 mM KH2PO4) (Backhausen 1994). Nach Einstellung des
„steady state“ bei der jeweiligen Lichtintensität, d.h. zu dem
Zeitpunkt an dem keine weiteren Änderungen zu beobachten waren (4
min), wurden O2-Produktionsrate, CO2-Einbaurate, photochemische
Löschung der variablen Fluoreszenz (qP), nicht-photochemische Löschung
der Chlorophyllfluoreszenz (qN), und Quantenausbeute am PS II (II)
berechnet.

Lichtintensität (µE)

0 200 400 600
Lichtintensität (µE)
0 200 400 600
Lichtintensität (µE)
Abbildung 7: Effekt von steigenden Lichtintensitäten auf die
Photosynthese isolierter Chloroplasten.
Chloroplastensuspensionen wurden in Parallelansätzen mit
Lichtintensitäten zwischen 10-700 µE belichtet. Die Berechnung der
Photosyntheseparameter erfolgte nach einer vierminütigen
Belichtungsdauer. A: Rate der Sauer­stoffproduktion (% der
Maximalrate, schraffierte Fläche, Erklärung s. Text); B: Rate der [14C]
CO2-Fixierung (% der Maximalrate); C: nicht-photochemische Löschung
der Fluoreszenz (qN); D: photochemi­sche Löschung der Fluoreszenz
(qP); E: Quantenausbeute von PS II (II).
In Zusammenhang mit der O2-Produktionsrate wird die mit Erhöhung der
Lichtintensität immer größer werdende Diskrepanz zwischen der
eingestrahlten Photonenmenge (schraffierte Fläche) und der für die CO2-Assimilation
tatsächlich genutzten Photonenanzahl offensichtlich. Unter
Berücksichtigung der Quantenausbeuten von PS II wird dann deutlich,
daß diese sich invers zur O2-Produktionsrate, zum 14CO2-Einbau und zum
pH-Gradienten verhalten. Bei steigenden Lichtintensitäten nimmt die
Quantenwirksamkeit immer stärker ab, während der Elektronendruck am
PS II immer weiter zunimmt. Unter diesen Bedingungen werden dann bis
zu 98% der Photonen als Wärmestrahlung abgegeben (Genty et al. 1989),
die aus technischen Gründen schlecht erfaßbar ist. Diese Befunde
verdeutlichen aber auch den Sachverhalt, daß in isolierten
Chloroplasten bei sättigendem CO2, Pi und Licht ein Großteil des
photosynthetischen Elektronenflusses nicht für die CO2-Assimilation
genutzt wird und dann für alternative reduktive Prozesse wie z.B.
Nitiritreduktion verwendet werden kann oder über die
„poising“-Mechanismen entsorgt werden muß.
Da der lineare Elektronentransport über das Fd/Td-System die reduktive
Aktivierung von verschiedenen stromalen Enzymen bewirkt, ist ein
direkter Zusammenhang zwischen dem anliegenden Elektronendruck und dem
Aktivierungszustand dieser Enzyme gegeben. Die Einstellung des
Aktivierungszustandes hängt individuell für jedes Enzym auch vom
Spiegel verschiedener während der CO2-Assimilation gebildeter
Calvin-Zyklus-Intermediate oder der Bereitstellung von
Reduktionsäquivalenten (NADPH) und Energie (ATP) ab. Aus diesem Grund
lag der Schwerpunkt der Untersuchungen auf der Bestimmung der
Aktivierungszustände von vier ausgewählten Enzymen, NADP-MDH,
NAD(P)-GAPDH, FBPase und PRK, die über diesen kombinierten Mechanismus
in ihrer Aktivität reguliert werden. Bei Bestimmung der
Lichtsättigungskurven für die einzelnen Enzyme zeigten sich deutliche
Unterschiede im Aktivierungsverhalten und es traten ebenfalls starke
Differenzen im prozentualen Anteil an aktivem Enzym auf (s. Abb. 8).
PRK wird schon bei sehr geringen Lichtintensitäten von 50 µE mit
Umsatzraten von 1600 µmol  mg Chl-1  h-1 als einziges der
untersuchten Enzyme zu 100% aktiviert. Das heißt der nach Belichtung
bestimmte Aktivierungszustand entspricht der nach Reduktion durch DTTred
gemessenen Aktivität. Neben der Redoxmodulation erfolgt die
Einstellung der PRK-Aktivität über die Konzentrationen der
Stroma-Metabolite 3PGA, ADP, SBP, FBP, Pi, Ru1,5bisP und
6‑Phosphogluconat, die in ihrer Wirkung durch einen sinkenden pH-Wert,
wie er beim Licht/Dunkel-Übergang auftritt, verstärkt werden (Gardemann et al. 1983).
So wird letztendlich im Dunkeln eine vollständige Inaktivierung des
Enzyms bewirkt und eine Koordination zwischen reduktivem und
oxidativem Pentosephosphatweg erreicht (Gardemann et al. 1983).
Der Aktivierungszustand der NAD(P)-GAPDH unterliegt im Licht über die
Dissoziation des reduzierten Enzyms, welche durch das Substrat
1,3bisPGA bewirkt wird, einem komplexen Regulationsmechanismus (Baalmann et al. 1995).
Im zeitlichen Verlauf spiegelt die Aktivierung des Enzyms die bei
Belichtung gleichzeitig ansteigende stromale Konzentration an
1,3bisPGA wider (Baalmann et al. 1994). Die im Standardansatz (50 µM
1,3bisPGA) bestimmte Dunkelaktivität betrug 150-200 µmol  mg Chl-1  h-1
und erreichte schon bei 50 µE den ca. fünffachen Wert von 700 µmol  mg Chl-1  h-1
(s. Abb. 8B). Dieser Aktivierungszu-stand war mit Erhöhung der
Lichtintensität auf 700 µE nicht steigerbar und entspricht 60% der
Kapazität. Vergleichbar mit der PRK benötigt die Aktivierung der
NAD(P)-GAPDH einen nur sehr geringen Elektronendruck.
Demgegenüber trat die Lichtsättigung der FBPase erst bei 200-250 µE
ein. Das Enzym wies dann mit Umsatzraten von 35 µmol  mg Chl-1  h-1
einen Aktivierungszustand von 22,8% der Kapazität auf (s. Abb. 8C).
Beim Vergleich mit dem Anstieg in der O2-Produktionsrate und dem 14CO2-Ein­bau
(s. Abb. 7A und 7B) wird deutlich, daß diese Parameter parallel zur
Zu­nahme der Aktivie­rungszustände der FBPase verlaufen. Die
Regulation der FBPase-Aktivität erfolgt durch ein Zu­sammenwirken von
reduktiver Aktivierung, pH-Wert, FBP- und Mg2+-Einfluß sowohl in der
Modifikationsphase, in welcher das Verhältnis von inaktivem zu
akti­vem Enzym verändert wird, als auch in der Katalyse, in der das
Substrat FBP in das Produkt F6P umgesetzt wird (vgl. Kap. 1.3.2).

C
A
B
D
Lichtintensität (µE)
Lichtintensität (µE)
Abbildung 8: Aktvierungszustände der PRK (A), NAD(P)-GAPDH (B),
NADP-MDH (C) und FBPase (D) in intakten isolierten Chloroplasten in
Abhängigkeit von der Lichtintensität.
Die Inkubation erfolgte im Standardansatz mit der jeweils angegebenen
Lichtintensität (0-700 µE). Nach vier Minuten Belichtungszeit wurden
Aliquots entnommen und die Aktivierungszustände der einzelnen Enzyme
bestimmt. Die aufgetragenen Aktivitäten entsprechen dem prozentualen
Anteil an maximal aktivierbarer Enzymmenge nach Reduktion durch DTTred.
Die korrespondierenden Aktivitätswerte sind dem Text zu ent­nehmen.
Ein ähnlicher Kurvenverlauf konnte für die NADP-MDH ermittelt werden
(s. Abb. 8D), wel­che als Teil des Malat-Ventils zur Stabilisierung
des ATP/NADPH-Verhältnisses beiträgt, in­dem zur Reduktion von
Oxalacetat zu Malat unter NADPH-Verbrauch ausschließlich
„Über­schußelektro­nen” genutzt werden (Scheibe 1987, Backhausen et al. 1994,
Fridlyand et al. 1998). Eine Fein­regulation erfolgt auf Ebene der
Reduktion durch das stro­male NADPH/NADP-Verhältnis, wobei hohe
NADPH/NADP-Verhältnisse das Gleichgewicht zugunsten der aktiven
(reduzierten) Enzymform verschieben (Scheibe & Jacquot 1983; Faske et al. 1994).
Der Aktivierungszustand des Enzyms ist somit ein Spiegel des jeweils
vor­herrschenden stromalen Redoxstatus (Backhausen et al. 1994). Bei
Erhöhung des Elektro­nendruckes über die Belichtung der
Plastidensuspension mit steigenden Lichtintensitäten liegt bei
Lichtsättigung (ab 150 µE) zwischen 40% und 55% des Enzyms in der
aktiven Form vor. Die meßbare Kapazität entspricht dann 140 µmol  mg Chl-1  h-1.
3.1.2 Einfluß verschiedener Effektoren auf den Aktivierungszustand von
ausgewähl­ten stromalen Enzymen und Photosyntheseparametern
Für die untersuchten stromalen Enzyme wurden unter Kontrollbedingungen
sowohl sehr unter­schiedliche Aktivierungsverhalten als auch
verschiedene Aktivitätseinstellungen in Abhängig­keit von der
Elektronen- und Effektorverfügbarkeit (eingestellt über die Belichtung
der Sus­pension mit stei­genden Lichtintensitäten; s. Abb. 8)
gefunden. Dieser Zusammenhang sollte im Weiteren analysiert werden,
indem gezielt der endogene Gehalt an Intermediaten, welche die
untersuchten Enzyme in ihrer Aktivierung beeinflussen, durch Zusatz
von Effektoren zum In­kubationsmedium erhöht oder er­niedrigt wurde.
Um einen höheren Gehalt an Triosen und letztendlich an FBP zu
erzielen, wurde das Medium mit 2,5 mM DHAP versetzt. Die Aufnahme von
DHAP erfolgt über den Triosephosphattrans­lokator im Gegentausch mit Pi
(Fliege et al. 1978). Eine erhöhte Pi-Konzentration im
Inkuba­tionsmedium bewirkt den gegenteiligen Effekt. Ein Anstieg der
1,3bisPGA-Konzentration wird über die kombi­nierte Zugabe von PGA und
ATP erreicht (Baalmann et al. 1994). Zum Ab­senken des ATP-Ge­haltes
wurde das aus dem phytopathogenen Pilz Alternaria tenius stam­mende
zyklische Tetrapep­tid Tentoxin zugesetzt. In sensitiven Pflanzen, wie
Spinacia olera­cea, bindet Tentoxin sehr spezi­fisch an die CF1-Untereinheit
der H+-ATPase und inhibiert in geringen Konzentrationen (2-5 µM) die
ATP-Synthese praktisch zu 100% (Sigalat et al. 1995). Um Änderungen im
Elektronendruck, linearen Elektronenfluß oder auch im transmembranen
Protonengradienten zu berücksichtigen, wurden unter sämtlichen
Bedin­gungen ebenfalls die qP- und qN-Werte sowie die O2-Produktionsraten
ermittelt.
Durch die Zugabe von 2 mM Pi erfolgt eine Herabsetzung der stromalen
Triosephosphat-Konzentration. Als Folge stehen dann nicht mehr
genügend TP für eine optimale Regeneration des CO2-Akzeptors RubBP zur
Verfügung, so daß eine starke Beeinträchtigung der CO2-Assimilation
bei gleichzeitig reduziertem ATP- und NADPH-Verbrauch zu erwarten ist.
Also ist die NADP-MDH als Indikator für den stromalen Redoxzustand
(vgl. Kap. 3.1.1) das geeignete Enzym, um die Änderungen im
NADPH/NADP-Verhältnis zu detektieren.
Die Zugabe von Pi ruft bei sättigendem Licht eine Erhöhung des
Aktivierungszustandes von 50% (unter Kontrollbedingungen) auf 70% der
Enzymkapazität hervor (s. Abb. 9A). Diese Steigerung gegenüber der
Kontrolle war schon bei Lichtintensitäten von 10 µE zu beobachten. Der
maximal mögliche Aktivierungszustand wurde bei 50 µE erreicht, d.h.
die Lichtsättigung der Enzymaktivierung ist zu geringeren
Lichtintensitäten hin verschoben.
Im Gegensatz dazu erfolgte eine Aktivierung der FBPase nur auf maximal
4% der Kapazität und war auch durch Erhöhung des Elektronendruckes bei
höheren Lichtintensitäten nicht zu steigern (s. Abb. 9B). Wie aus den
unter diesen Bedingungen stark verringerten qP-Werten (von z.B. 0,192
im Vergleich zu 0,485 in den Kontrollansätzen) bei einer
Lichtintensität von 150 µE deutlich wird, bewirkte der Pi-Zusatz an
sich schon eine extreme Erhöhung im Reduktionsgrad des PS II
(s. Abb. 10A). Vergleichbare Werte wurden auch nach Belichtung mit
Lichtintensitäten ab 1300 µE bestimmt (Daten nicht gezeigt). Offenbar
wird durch die Erhöhung des Elektronendruckes keine höhere Aktivierung
der FBPase erreicht. Über die Bestimmung der qP-Werte allein kann
keine Aussage über die Elektronentransportrate gemacht werden, da hohe
qP-Werte sowohl von einem hohen linearen Elektronenfluß, als auch von
einem Akzeptormangel verursacht werden können. Die fast vollständig
unterdrückte CO2-abhängige O2-Produktionrate mit Werten zwischen 0,9
und 8,2 µmol  mg Chl-1  h-1, die jeweils parallel zu den
Fluoreszenzmessungen determiniert wurde, zeigt deutlich, daß auch bei
steigenden Lichtintensitäten die Elektronentransportrate minimal ist
(s. Abb. 10C). Demgegenüber blieben die Aktivierungszustände der PRK
und NAD(P)-GAPDH unbeeinflußt (Daten nicht gezeigt). Auch der
transmembrane Protonengradient (qN) entsprach in diesem Fall den unter
Kontrollbedingungen bestimmten Werten (s. Abb. 10B).

C
B
D
A
Abbildung 9: Einfluß verschiedener Effektoren auf die
Aktivierungszustände von NADP-MDH (A), FBPase (B), NAD(P)-GAPDH (C)
und PRK (D).
Die Inkubation isolierter intakter Chloroplasten erfolgte im
Standardinkubationsmedium (Kontrolle, ) dem folgende Effektoren
zugegeben wurden: 2,2 mM Pi (A, B ), 2,5 mM DHAP (), 2,5 mM PGA (),
0,25 mM PGA + 0,5 mM ATP (), 2,2 mM Pi + 5 µM Tentoxin (C, D ),
2,5 mM ATP (). Die Aktivie­rungszustände wurden nach vier Minuten
Belichtung mit der jeweils angegebenen Lichtintensität bestimmt und
sind in der Grafik als prozentualer Anteil der Kapazität des
jeweiligen Enzyms dargestellt.
Die Zugabe von 2,5 mM DHAP wirkte dagegen schon bei den geringen
Lichtintensitäten von 10 µE bzw. 50 µE stimulierend auf den
Aktivierungszustand der FBPase und bei Einstrahlen von 150 µE war die
Lichtsättigung der Aktivierung erreicht (s. Abb. 9B). Der gemessene
Aktivierungszustand (28% der Kapazität) entspricht dann bei geringem
Elektronendruck den Werten, die nach einer Belichtungszeit von acht
Minuten mit 700 µE maximal meßbar sind (s. Abb. 8). In Abhängigkeit
von der Zeit verursacht die Zugabe von DHAP ein schnelles Ansteigen
der FBPase-Aktivität innerhalb der ersten Minuten. Ein besonders
deutlicher Unterschied war bei höheren Lichtintensitäten zu
beobachten. Die Werte lagen 9-10% über den Aktivierungszuständen des
Enzyms in den entsprechenden Kontrollproben. Nach sechs- bis
achtminütiger Belichtung lagen die FBPase-Aktivierungszustände nach
DHAP-Zugeabe dann nur noch geringfügig über den unter
Kontrollbedingungen ermittelten Werten (Daten nicht gezeigt). Höhere
Werte wurden auch nach Belichtung mit 1300 µE nicht bestimmt (Daten
nicht gezeigt). Als weiterer Effekt ist eine verglichen mit den nach Pi-Zugabe
erhaltenen Werten fast identische Erniedrigung der qP-Werte zu
verzeichnen (s. Abb. 10A). Ein Einfluß konnte ebenfalls auf den pH
festgestellt werden, der verglichen mit der Kontrolle und den nach Pi-Gabe
erhaltenen Werten stark verringert war (s. Abb. 10B). Die Rate der O2-Produktion
entspricht bei der jeweiligen Lichtstärke nur etwa einem Viertel der
unter Kontrollbedingungen ermittelten Raten (s. Abb. 10C). Demzufolge
bewirkt DHAP, neben Erhöhung der stromalen Konzentration an DHAP und
der nachgeschalteten Erhöhung an FBP, ebenfalls einen Anstieg des
Elektronendruckes bei einem gleichzeitig verringerten transmembranen
Protonengradienten und einer verringerten linearen
Elektronentransportrate.
A
D

1



0
,
8


0
,
6


0
,
4

0
,
2

B
E

0


Lichtintensität (µE)
C
8
6
4
2
Lichtintensität (µE)
Abbildung 10: Einfluß verschiedener Effektoren auf die Photosynthese
isolierter intakter Chloroplasten.
Dem Standardinkubationsmedium (Kontrolle, ) wurden folgende
Effektoren zugegeben: 2,2 mM Pi (); 2,5 mM DHAP (); 2,5 mM PGA ();
0,25 mM PGA + 0,5 mM ATP (). Die Parameter wurden nach vier Minuten
Belichtung mit der jeweils angegebenen Lichtintensität bestimmt. A, D:
photochemische Löschung der variablen Fluoreszenz; B, E:
Nicht-photochemische Löschung der variablen Fluoreszenz; C: CO2-abhängige
O2-Produkti­onsrate.
Die Belichtung der Plastiden in Gegenwart von 2,5 mM PGA führte zu
einer Verringerung des Aktivierungszustandes der NADP-MDH. Dieser lag
besonders bei niedrigeren Lichtintensitä­ten von beispielsweise 50 µE
bis zu 30% unter den Kontrollwerten und wies bei 700 µE nur noch 10%
Differenz zur Kontrolle auf. Das heißt zu höheren Lichtintensitäten
hin, welche mit einem höheren Elektronenfluß einhergehen, nähert sich
der Aktivierungszustand dem Kontrollniveau an (s. Abb. 9A). Diese
Nivellierung trat ebenfalls deutlich nach Bestimmung der qP- und
qN-Werte in Er­scheinung. Bei allen geringeren Lichtintensitäten wurde
ein verrin­gerter Reduktionsgrad des PS II (höhere qP-Werte,
s. Abb. 10F) mit einem parallel dazu eben­falls leicht erniedrigten pH
(s. Abb. 10E) bestimmt. Bei Lichtintensitäten von 700 µE waren diese
Unterschiede nicht mehr vorhanden. Generell weist der verringerte
Aktivierungszustand der NADP-MDH auf eine Senkung des stro­malen
Redoxstatus hin. Diese Verschiebung im NADPH/NADP-Verhältnis wird dann
über eine erhöhte PGA-Reduktion zu Triosephosphaten unter
gleichzeitigem NADPH-Verbrauch hervorgerufen.
Eine Änderung im Aktivierungszustand der NAD(P)-GAPDH ist unter diesen
Bedingungen nicht zu erwarten, da die ATP- und PGA-Gehalte im Stroma
gegenläufige Veränderungen zei­gen (Baalmann et al. 1994). Die erhöhte
PGA-Reduktion bedingt eine Verringerung im ATP/ADP-Verhältnis (Fridlyand et al. 1997),
so daß durch die begrenzte ATP-Verfügbarkeit der PGA-Umsatz durch die
PGK eingeschränkt wird (Caver & Walker 1983; Furbank & Horton 1987).
Dementsprechend bleibt der Gehalt an 1,3bisPGA, welcher maß­geblich an
der Einstellung des Enzymaktivierungszustandes beteiligt ist,
unbeeinflußt. 3PGA allein verursacht erst ab Konzent­rationen von 5 mM
eine eher als marginal zu betrachtende Aktivierung (Baalmann et al. 1994).
Ein verringerter Aktivierungszustand der NAD(P)-GAPDH von 20% im
Vergleich zur Kontrolle wurde erst durch einen kombinierten Einsatz
von Pi und Tentoxin hervorgerufen (s. Abb. 9C). Diese reduzierte
Aktivierbarkeit war unab­hängig von der einge-strahlten Photonenmenge.
Da keine CO2-abhängige O2-Entwicklung er­folgte (Daten nicht gezeigt),
ist auch hier von einer stark reduzierten Elektronenverfügbarkeit
auszugehen. Als verstärkender Effekt ist die wohl vermin­derte Menge
an 1,3bisPGA anzufüh­ren, da unter diesen Bedingungen sowohl der
stromale ATP- als auch der PGA-Gehalt verrin­gert sind. Demgegenüber
konnte schon ab 50 µE eine 100%ige Aktivierung der NAD(P)-GAPDH durch
Zusatz von 0,5 mM PGA plus 0,25 mM ATP induziert werden (s. Abb. 9C).
Die endogene Erhöhung des Substrats 1,3bisPGA, das gleichzeitig einen
positiven Effektor für die Enzymaktivierung darstellt, kann schon bei
geringen Elektronenflüssen somit die gesamte vorhandene Enzymmenge in
die aktive Form überführen. Verglichen mit dem Zusatz von 2,5 mM PGA
allein ist der Aufbau des pH geringer, während für den Reduktionsgrad
im PS II ein identischer Kurvenverlauf ermittelt wurde (s. Abb. 10E).
Es ist ebenfalls die Tendenz zu verzeichnen, daß die Unterschiede
gegenüber der Kontrolle in Richtung höherer Lichtstär­ken geringer
werden oder im Fall von qP nicht mehr vorhanden sind.
Eine ähnlich starke Reduktion erfolgte im Aktivierungszustand der PRK
nach Zugabe von Tento­xin plus Pi-Zugabe während 2 mM ATP keinen
Einfluß ausübten (s. Abb. 9D). Durch Gabe von Tentoxin allein konnte
sowohl der Aktivierungszustand der PRK als auch der der NAD(P)-GAPDH
auf Werte eingestellt werden, die zwischen dem Kontrollniveau und dem
nach Zugabe von Tentoxin plus 2,2 mM Pi-Zusatz bestimmten Grad der
Aktivierung lagen (Daten nicht ge­zeigt).
3.1.3 Beziehungen zwischen FBPase-Aktivierungszuständen, FBP-Gehalten
und Elektronendruck
An der isolierten FBPase konnte anhand von
Thiol/Disulfid-Gleichgewichts-Titrationen eine Abhängigkeit der
Enzymaktivierung von den Verhältnissen an DTTred/DTTox gezeigt werden
(Faske et al. 1995). Eine extreme Erniedrigung des Redoxpotentials
wurde durch Anwesenheit des Substratanalogons CaFBP hervorgerufen, das
somit offensichtlich einen positiven Effekt auf die reduktive
Aktivierung ausübt. Im Weiteren war nun von Interesse, ob die
Einstellung der FBPase-Aktivierungszustände im Chloroplasten den
gleichen Regulationsmechanismen unterliegt. Diese Analyse sollte unter
Berücksichtigung sämtlicher sich vor allem auch unter den
verschiedenen Bedingungen ändernder Parameter erfolgen.
Daher wurden zunächst die stromalen FBP-Gehalte unter
Kontrollbedingungen und nach Zu­gabe von 2,5 mM DHAP und 2,2 mM Pi in
Abhängigkeit von der Lichtintensität bestimmt (s. Abb. 11). Unter
Kontrollbedingungen ist mit steigender Lichtintensität eine
kontinuierliche Zunahme im stromalen FBP-Gehalt von 1,19 nmol  mg Chl-1 ± 0,305
bei 10 µE auf 2,7 nmol  mg Chl-1 ± 0,44 bei 700 µE zu verzeichnen.
Die bei Lichtsättigung mit wässrig iso­lierten Chloroplasten
bestimm­ten Werte ergeben im Vergleich mit den in der Literatur
be­schriebenen Daten eine gute Überein­stimmung (Purzceld et al. 1978,
Portis et al. 1977). Eine deutliche Diskrepanz besteht zu Daten, die
mit nichtwäßrig isolierten Chloroplasten bzw. Protoplasten ermittelt
wurden (Sharkey et al. 1986; Heineke et al. 1991). Als Ursache ist der
schon während der Isolierung vorhandene extreme Konzentrationsgradient
zwischen Plastid und Medium anzuführen, durch den ein Großteil der
Metabolite, wie PGA, DHAP und FBP verloren geht (Kitzmann 1996).



Abbildung 11: Effekt von 2,5 mM DHAP und 2,2 mM Pi auf den stromalen
FBP-Gehalt unter dem Einfluß variierter Lichtintensitäten.
Die Inkubation erfolgte im Standardansatz (Kontrolle, ), wobei zwei
Minuten vor Belichtungsbeginn die Effektoren 2,2 mM Pi () und 2,5 mM
DHAP () zugesetzt wurden. Die FBP-Gehalte wurden enzymatisch nach
Silikonölzentrifugation bestimmt. Die Probennahme erfolgte nach
vierminütiger Belichtung. (n=3-4)
Nach Inkubation der Chloroplasten mit 2,5 mM DHAP erreichte der
FBP-Gehalt infolge der DHAP-Aufnahme über den Phosphattranslokator und
der nachgeschalteten Umsetzung über die Gleichgewichtsreaktionen von
Triosephosphatisomerase und Aldolase zu FBP schon bei 10 µE Werte von
2,59 nmol  mg Chl-1 ± 1,76. Dieser Gehalt ist vergleichbar mit dem,
der bei einer Lichtintensität von 700 µE unter Kontrollbedingungen zu
finden ist. Im Weiteren führte die Erhö­hung der Lichtintensität nur
zu einem Anstieg des FBP-Gehaltes bis zu 3,78 nmol  mg Chl-1 ± 0,5
bei 700 µE, d.h. eine drastische Erhöhung in Abhängigkeit von der
Lichtintensität erfolgte nicht. Der FBP-Gehalt zeigte sich ebenfalls
nach Zugabe von 2,2 mM Pi nahezu unabhängig von der eingestrahlten
Lichtintensität, nur daß die hohe Pi-Kon­zentration zu einer starken
Verarmung an stromalem FBP im Vergleich zur Kontrolle führte. Bei
sämtlichen Lichtintensitäten lagen die Werte um 1 nmol  mg Chl-1
(s. Abb. 11).
Um nun Informationen über die Zusammenhänge zwischen
FBPase-Aktivierungszustand und FBP-Gehalt bzw. Elektronendruck zu
erhalten, wurden die Werte der Enzymaktivität und der Substratmenge
(FBP) sowie des Elektronendruckes (qP) und der NADP-MDH-Aktivität (als
Maß für den stromalen Redoxzustand) gegeneinander aufgetragen
(s. Abb. 12).
Bei separater Betrachtung bestand zwischen FBPase-Aktivität und
FBP-Gehalt sowohl unter Kontrollbe­dingungen als auch unter den
variierten Bedingungen (DHAP, Pi) für die einzelnen Lichtintensitäten
(10-700 µE) ein linearer Zusammenhang. Dabei geht eine steigende
FBP-Konzentration immer mit einem erhöhten FBPase-Aktivierungszustand
einher. Die Daten sind nicht gesondert dargestellt, können aber
Abbildung 12A entnommen werden.
Ein einzelner linearer Zusammenhang ist nicht vorhanden bei
Zusammenfassung sämtlicher Daten in eine Grafik (s. Abb. 12A). In
diesem Fall ergaben sich zwei voneinander getrennte lineare
Abhängigkeiten. Zum einen besteht eine Beziehung zwischen den Daten,
die bei 10 µE und 50 µE ermittelt wurden und zum anderen zwischen
denen, die bei höheren Intensitäten bestimmt wurden. Somit führte
offenbar die alleinige Steigerung des stromalen FBP-Gehaltes, der nach
DHAP-Zusatz bei allen Lichtstärken nahezu identisch ist, nicht zu
einem entspre­chend höheren Aktivierungszustand des Enzyms. Dies legt
die Vermutung nahe, daß bei 10 µE bzw. 50 µE eine Limitierung durch
mangelnde Elektronenverfügbarkeit hervorgerufen wird.
Deshalb wurden qP und die Aktivierungszustände in Beziehung gesetzt
(s. Abb. 12B). Deut­lich wird, daß auch die Steigerung des
Elektonendruckes bei Substratmangel keinen höheren
Aktivie­rungszustand bewirkte (Pi-Zusatz: Daten in der Grafik links).
Zwischen den unter Kontrollbedin­gungen und den nach DHAP-Zugabe
ermittelten Werten wurde eine Abwei­chung von der Linea­rität
gefunden. Invers dazu ist der Kurvenverlauf, der sich für die
Bezie­hung der Aktivierungszu­stände zwischen FBPase und NADP-MDH (Maß
für den stromalen Redoxstatus), ergibt (s. Abb. 12C). Demgegenüber
zeigte die Aktivität der NADP-MDH unter allen Bedingungen eine lineare
Abhängigkeit vom qP (s. Abb. 12D).
C
B
A
D

NADP-MDH-Aktivierungszustand
(% Vmax)
0 10 20 30
FBPase-Aktivierungszustand (% Vmax)




Abbildung 12: Zusammenhang zwischen dem Aktivierungszustand der FBPase
und dem stromalen Gehalt an FBP (A), dem qP (B), dem
Aktivierungszustand der NADP-MDH (C) und Beziehung zwischen dem
Redoxstatus und dem Aktivierungszustand der NADP-MDH.
Die in der Abbildung enthaltenen Werte sind Abbildung 9A (NADP-MDH) (D)
oder Abbildung 9B (FBPase) (A-C) und wurden mit den Werten aus
Abbildung. 11 (A), Abbildung 10B (B und D) und Abbildung 9A (C)
kombiniert. Die Werte wurden jeweils in Abhängigkeit von der
Lichtintensität unter Kontroll­bedingungen, nach Zugabe von 2,5 mM
DHAP oder 2,2 mM Pi bestimmt. 10 µE: ; 50 µE: ; 150 µE: ; 300 µE: ;
700 µE: .
3.1.4 Effekt von Elektronenakzeptoren auf diverse
Photosyntheseparameter und den Aktivierungszustand ausgewählter
stromaler Enzyme
Im ersten Teil der Ergebnisse wurde die Beeinflußung von
Photosyntheseparametern und Enzymaktivitäten durch variierte
Lichtintensitäten und ver­schiedene Calvin-Zyklus-Intermedi­ate
unter­sucht. Im zweiten Teil sollte die Wirkung von verschiedenen
Elektronenakzeptoren auf den plastidären Redoxzustand während der
„steady state“-CO2-Fixierung bei konstantem Licht be­trachtet werden.
Eine Veränderung des Elektronenflusses erfolgte durch Zusatz der im
Chloroplasten vor­kommenden Elektronenakzeptoren OAA (0,2 mM und 2 mM)
und Nitrit (0,2 mM und 2 mM) sowie dem artifiziellen Akzeptor
Methylviologen (2 µM, 4 µM und 10 µM). Die Zugabe erfolgte nach vier
Minuten Belichtungszeit bei einer konstanten Lichtin­tensität von
700 µE. All diese Komponenten verursachen einen Verbrauch von
Elektronen ohne zusätzlichen ATP-Umsatz. Dadurch ist eine Veränderung
im stromalen [NADPH]/[ATP]-Verhältnis zu erwarten, welches neben der
Einstellung von Enzym­aktivitäten für eine angepaßte CO2-Fixierung
erforderlich ist.
Ein großer Unterschied besteht allerdings in der Wirkungsweise der
verwendeten Elektronen­akzeptoren: OAA wird unter NADPH-Verbrauch von
der NADP-MDH zu Malat umgesetzt, wobei die Rate der Reduktion über den
Aktivierungszustand des Enzyms kontrolliert wird (Backhausen et al. 1994).
Im Gegensatz dazu erfolgt bei Methylviologen und Nitrit der
Elek­tronenübergang direkt vom reduzierten Fd aus. Die
Nitrit-Reduktion wird durch die Nitritre­duktase katalysiert (Vega et al. 1980).
Die Umsatzrate ist rein konzentrationsabhängig und läuft mit hoher
Affinität ab, da keine metabolische Regulation des Enzyms bekannt ist
(Bayersdorfer & Robinson 1985). Eine Nitrit-Akkumulation im Stroma
bewirkt u.a. eine Abnahme des pH-Wertes (Purczeld et al. 1978). Die
Folge ist eine Veränderung von Aktivi­täten pH-abhängiger Enzyme und
auf diese Weise zu artifiziellen Ergebnissen führt (Robinson 1988).
Methylviologen hingegen katalysiert einen Elektronentransfer von
reduziertem Fd auf O2 (Asada 1990), d.h. der Elektronenfluß zum
Methylviologen läuft ohne Netto-O2-Gewinn ab. Die dabei entstehenden,
für den Chloroplasten toxischen O2-Radikale werden durch die
Superoxiddismutase und Komponenten des Ascorbat-Glutathion-Zyklus
unschädlich gemacht (Polle 1996).
Für einen umfassenden Überblick wurden die Aktivierungszustände von
NADP-MDH, FBPase, NAD(P)-GAPDH und PRK, diverse Photosyntheseparameter
(14CO2-Einbau, CO2-abhängige O2-Freisetzung, qP, qN) sowie
Verschiebungen im ATP/ADP- bzw. NADPH/NADP-Verhältnis und
Veränderungen im stromalen Intermediatgehalt (PGA, DHAP, FBP)
bestimmt. Im Rahmen dieser Arbeit erfolgte die Messung der
Enzymaktivierungszu­stände, während die übrigen Daten von Camillo
Kitzmann (ehemals Humboldt Universität, Berlin) und Jan E. Backhausen
(Universität Osna­brück) erstellt wurden.
Unter Kontrollbedingungen wurde bereits gezeigt, dass die
Aktivierungszustände der einzelnen Enzyme bei verschiedenen
Lichtintensitäten variierten (s. Abb. 8A-D). Auch die zeitabhängige
Aktivierung der Enzyme während der Induktionsphase der CO2-Assimilation
sowie die Reak­tion der Enzyme auf die Zugabe der verschiedenen
Elektronenakzeptoren (s. Abb. 13A-P) dif­ferierte beträchtlich.
Die FBPase ist im Dunkeln inaktiv. Bei Belichtung wurde in den
Kontrollen bis zu einem Zeit­raum zwischen sechs und acht Minuten ein
kontinuierlicher Aktivitätsanstieg bis auf 55 µmol  mg Chl-1  h-1  6,9
verzeichnet. Nach Zugabe von 0,2 mM oder 2 mM OAA (s. Abb. 13A) trat
keine Veränderung im Aktivierungszustand des Enzyms auf. Auch 0,2 mM
Nitrit (s. Abb. 13B) und die Kom­bination aus 0,2 mM OAA plus 0,2 mM
Nitrit (s. Abb. 13C) übten nur einen geringen Einfluß aus.
Vergleichbare Werte wurden nach Zugabe von 0,2 mM Nitrit bzw. nach
Zugabe von Nitrit plus OAA erzielt. Eine extreme Abnahme des
Aktivie­rungszustandes auf 13% des Kontrollwertes erfolgte bei Zugabe
von 2 mM Nitrit (s. Abb. 13B), während Methylviologen unabhängig von
der Konzentra­tion ähnliche Endwerte lieferte (s. Abb. 13D).
Eine nahezu vollständige Insensitivität gegenüber sämtlichen
Akzeptoren zeigten sowohl NAD(P)-GAPDH als auch PRK. Bei Belichtung
stieg der NAD(P)-GAPDH-Aktivierungszu­stand innerhalb von drei bis
vier Minuten von einer Dunkelaktivität von 150-200 µmol  mg Chl-1  h-1
um das ca. fünffache auf einen Wert von 687 µmol  mg Chl-1  h-1 ±
14,4 (53% der Kapazität) an. Ein gerin­ger Anstieg war nach Zugabe von
Nitrit plus OAA zu verzeichnen (s. Abb. 13G), während 4 µM
Methylviologen eine leichte Abnahme des Aktivie­rungszustandes
hervorrief (s. Abb. 13H).
Die Aktivierung der PRK war hingegen schon innerhalb der ersten zwei
Minuten nach Beginn der Belichtung abgeschlossen. Das Enzym war dann
mit Umsatzraten von 998,6 µmol  mg Chl-1  h-1 ± 20,9 vollständig
aktiviert. Dieser Aktivierungszustand nahm nach Zusatz von 2 mM Nitrit
(s. Abb. 13K), Nitrit plus OAA (s. Abb. 13K), sowie bei Zugabe von
Methylvio­logen (s. Abb. 13L) bis zum Ende der Belichtungszeit um
10-15% im Vergleich zum Kon­trollwert ab.


Abbildung 13: Einfluß von Elektronenakzeptoren auf die
Aktivierungszustände von FBPase (A-D), NAD(P)-GAPDH (E-H), PRK (I-L),
NADP-MDH (M-P) in isolierten, intakten Chloroplasten.
Die Inkubation erfolgte im Standardansatz (, unbehandelte Kontrolle),
wobei nach vier Minuten Belich­tung, gekenn­zeichnet durch einen
Pfeil, wurden 0,2 () oder 2 mM OAA (), 0,2 () oder 2 mM Nitrit (),
2 () oder 4 µM Methylviologen () zugegeben wurden. Bei dem
kombinierten Zusatz von 0,2 mM Nitrit und 0,2 mM OAA () wurde nach
drei Minuten Nitrit zugefügt und eine Minute später OAA. Die einzelnen
Bedingungen sind rechts mit blauer Schrift verzeichnet. OAA:
Oxalacetat, MV: Methylviologen. n=2-5
Im Gegensatz dazu reagierte die NADP-MDH auf jede Änderung der
stromalen Redoxsitua­tion mit einem drastischen Abfall des
Aktivierungszustandes. Unter Kontrollbedingungen im Dunklen ist das
Enzym inaktiv. Nach Einsetzen der Belichtung wurde eine für dieses
Enzym typische Akti­vierungskurve bestimmt. Innerhalb von zwei Minuten
stieg die Aktivität auf 60% der Kapaziät an und erreichte damit ein
Maximum. Im weiteren zeitlichen Verlauf sank der Aktivierungszustand
wieder ab und erreichte nach drei bis vier Minuten stabile Werte von
86 µmol  mg Chl-1  h-1  8,6, die dann 54% der Maximalaktivität
entsprechen. Ein Anstieg des Aktivierungszustandes zum Ende der
Belichtungsperiode ist auf den im isolierten Chloro­plasten ebenfalls
leicht ansteigenden Redox­status (ARC) des Stromas zurückzuführen (Backhausen et al. 1994,
Kitzmann 1996). Unmittelbar nach Zugabe von 0,2 bzw. 2 mM OAA
(s. Abb. 13M) sank der Aktivierungszustand auf die Hälfte des
Kontrollwertes ab, wobei die Kombination aus Nitrit und OAA zu ähnlich
ge­ringen Aktivitäten wie mit 2 mM Nitrit allein (15% der Kapazität)
führte (s. Abb. 13O). Im weite­ren zeitlichen Verlauf war in allen
drei Ansätzen eine kontinuierliche Aktivitätszunahme zu ver­zeichnen,
im Fall der OAA-Behandlungen lag die Aktivität zum Versuchsende nur
noch 15% unter der der Kontrolle. Der Zusatz von 0,2 mM Nitrit
bewirkte ein sofortiges Absinken des Aktivie­rungszustandes auf 38%
des Kontrollwertes und bewegte sich demnach zwischen den für OAA und
Nitrit allein oder plus OAA ermittelten Aktivitäten. Ein
vergleichbarer Effekt wurde nach Methylviologen-Zugabe beobachtet,
wobei unter diesen Bedingungen die Aktivität nicht sofort drastisch,
son­dern stetig über den Versuchszeitraum sank (s. Abb. 13P). Die
extremste Abnahme der NADP-MDH-Aktivität, bis auf 5% der Kontrolle,
wurde für die Behandlung der Chloro­plastensupen­sion mit 2 mM Nitrit
gefunden (s. Abb. 13N).
Die Zugabe der verschiedenen Elektronenakzeptoren resultierte
ebenfalls in Änderungen der Chlorophyllfluoreszenz, was auf einen
veränderten Redoxstatus und eine veränderte Energeti­sie­rung der
Thylakoide hinweist. Bis zur Einstellung der „steady
state“-Photosynthese (drei bis vier Minuten) zeigten sowohl qP als
auch qN den typischen, transienten Verlauf, d.h. nach drei bis vier
Minuten waren stabile Werte erreicht (Daten nicht gezeigt). Die
Effektorzugabe er­folgte jeweils nach vier Minuten Belichtung. Der
Einfluß auf die Chlorophyllfluoreszenz wurde dann zwei Minuten später
(nach sechs Minuten Belichtung) bestimmt. Die ermittelten Daten sind
in Tabelle 3 zusammengefaßt.
Bei Zugabe der moderateren Akzeptoren, wie 0,2 mM und 2 mM OAA sowie
0,2 mM Nitrit erfolgte die Einstellung der Aktivierungszustände auf
ein neues stabiles Plateau innerhalb von ein bis zwei Minuten nach
Zugabe. Diese Bedingungen bewirkten eine Zunahme der qP-Werte, während
qN mit Werten um 0,68 nahezu unverändert blieb. Im Gegensatz dazu
zeigte qN nach Zugabe von 2 mM Nitrit oder nach Zugabe von
Methyl­viologen (2 bzw. 10 µM) einen Anstieg auf 0,73. Für qP wurde
keine signifikante Abweichung von den Kontrollwerten gefunden. Bei
Methylviologen-Zugabe wurden über den Versuchs­zeitraum keine stabilen
Werte bestimmt, insbesondere nahm qP kontinuierlich ab und erreichte
nach zehn Minuten einen Wert von 0,16. Die für qN ermittelten Werte
lagen zu diesem Zeitpunkt 10% über den Kontrollwerten (Daten nicht
gezeigt).
Die zusätzlichen Elektronenakzeptoren riefen weiterhin Ände­rungen im
Pyridinnukleotid-Redoxstatus und im Energiestatus der Chloroplasten
hervor. Der Reduktionszustand des NADPH-„pools“ (in Tabelle 3 als ARC
angegeben) wies insgesamt nur eine geringe Abnahme auf. Die Zugabe von
0,2 mM Nitrit bzw. OAA oder auch die Kombination aus beiden
verur­sachte ein geringes Absinken des ARC von etwa 10% im Vergleich
zur Kontrolle (0,12 mM NADPH), obwohl im Fall von OAA plus Nitrit
schon eine Hemmung des 14CO2-Ein­baus eintrat. Auch unter dem Einfluß
von 2 mM Nitrit und 2 µM Methylviologen bei einer gleich­zeitig fast
vollständigen Hemmung der CO2-Fixierung und O2-Produktionsrate erfuhr
der ARC keine weitere signifikante Abnahme. Eine stärkere Abweichung
von den Kontrollwerten er­folgte erst nach Zusatz von 10 µM
Methylviologen (0,092 mM NADPH). Für das ATP/ADP-Verhältnis wurden
hingegen signifikante Abweichungen von den Kontrollen gefunden. So
induzierten die schwächeren Akzeptoren (OAA, 0,2 mM Nitrit) nur einen
Anstieg auf 105% der Kontrolle (0,29 mM ATP), während eine extreme
Zunahme in der ATP-Konzentration nach Zugabe von 2 mM Nitrit- bzw.
5 µM Methylviologen auftrat, und der ADP-Gehalt von 0,32 mM auf
0,21 mM sank. Die Änderung im ATP/ADP-Verhältnis wurde unter allen
Bedin­gungen durch eine Abnahme im AMP-Gehalt balanciert (Kitzmann
1996). Dieser betrug unter Kontrollbedingungen 0,09 mM, sank bei OAA
und 0,2 mM Nitrit auf 0,06 mM und fiel bei allen anderen Bedingungen
unter die Detektionsgrenze.
Tabelle 3: Einfluß externer Elektronenakzeptoren auf diverse
Photosyntheseparameter und die stro­malen Intermediatgehalte.
ATP, ADP; AMP (mM) wurden luminometrisch und die NADP- und
NADPH-Konzentrationen (mM) mit­tels „enzymatic cycling“ gemessen1. Die
Bestimmung der Gehalte an PGA, DHAP und FBP erfolgte enzy­matisch nach
Silikonölzentrifugation, wobei die stromale Konzentration (mM) in den
Pellets und die Export­raten (µmol  mg Chl-1  h-1) aus den Gehalten
der Überstände ermittelt wurden (s. Kap. 2.9)1,2. Die O2-Frei­setzungsrate
(µmol  mg Chl-1  h-1) wurde polarographisch bestimmt (s. Kap. 2.3.2)1,2,3
und die Rate der CO2-Fixierung (µmol  mg Chl-1  h-1) als 14CO2-Einbau
in säurestabile Produkte ermittelt (s. Kap. 2.3.3)1,2. qP =
photochemische Löschung der Fluoreszenz2,3; qN = nicht-photochemische
Löschung der Fluoreszenz2,3; MV=Methylviologen. Die Werte stellen
Mittelwerte aus mindestens drei unabhängigen Messungen dar, deren
Abweichung bis zu 10% betrugen.
Kontrolle
OAA
0,2 mM
OAA
2 mM
Nitrit
0,2 mM
Nitrit
2 mM
MV
2 µM
MV
10 µM
qP
0,223
0,270
0,266
0,277
0,220
0,229
0,209
qN
0,670
0,660
0,660
0,680
0,271
0,724
0,735
ARC
0,444
0,398
0,397
0,418
0,397
0,397
0,336
ATP/ADP
0,906
1,103
1,100
1,150
2,179
1,420
2,286
PGA
2,798
2,239
2,239
1,960
0,740
2,198
0,448
DHAP
0,169
0,255
0,252
0,244
0,314
0,221
0,306
FBP
0,122
0,164
0,162
0,158
0,378
0,156
0,441
O2-Produktion
92,0
102,1
103,0
103,8
100,4
89,0
22,6
14CO2-Einbau
98,0
98,7
97,5
95,3
32,7
57,2
13,6
DHAP-Export
22,3
21,9
22,0
21,5
13,2
22,0
13,9
PGA-Export
13,0
11,7
11,2
12,3
2,0
7,1
0,5
Die Daten wurden ermittelt von: 1 Camillo Kitzmann; ehemals Humboldt
Universität, Berlin
2 Jan E. Backhausen; Universität Osnabrück
3 diese Arbeit
Um Einblick in die Effekte zu gewinnen, die die Elektronenakzeptoren
auf den Calvin-Zyklus ausüben, wurden Änderungen in den
Intermediatgehalten von PGA, DHAP und FBP bestimmt. In
Dunkel-adaptierten Plastiden sind die Konzentrationen dieser
Intermediate sehr gering und mit Einsetzen der Belichtung ist ein
paralleler Anstieg zu den Raten der O2-Freisetzung und CO2-Fixierung
zu beobachten, wobei nach Einstellung des „steady state“ ein stabiles
Niveau erreicht wird (Daten nicht gezeigt). Die Akzeptorzugabe
bewirkte in allen Fällen eine Ab­nahme der PGA-Konzentration, wobei
diese mit sinkendem Redoxstatus, gemessen an dem jeweiligen
Aktivie­rungszustand der NADP-MDH (vgl. Abb. 13M-P), ebenfalls
gleichlaufend abnahm.
Dabei wurde wiederum eine klare Abhängigkeit von der Stärke des
Effektors in fol­gender Abstufung deutlich: 0,2 mM und 2 mM OAA  0,2 mM
Nitrit  0,2 mM Nitrit plus 0,2 mM OAA  2 mM Nitrit  10 µM
Methylviolo­gen. Die Behandlung mit OAA bzw. 0,2 mM Nitrit induzierte
eine Abnahme des PGA-Gehaltes auf 90% der Kontrolle (2,8 mM) und die
Kombination beider Akzeptoren führte zu einer 40%igen Reduktion des
PGA-Spie­gels. Unter Zugabe von 2 mM Nitrit oder 10 µM Methylviologen
wurden nur noch 0,75 mM bzw. 0,45 mM PGA bestimmt, was einem
prozentualen Anteil des Kontrollwertes von 30% bzw. 15% entspricht und
zum Ende des Versuchs (10 min) entsprach der PGA-Gehalt annä­hernd dem
Dunkelniveau. Bei den hohen Konzentrationen an Nitrit bzw.
Methylviologen er­folgte im zeitlichen Verlauf keine Regeneration des
jeweiligen PGA-Spiegels, wie dieses bei den anderen Akzeptoren
beo­bachtet wurde (Kitzmann 1996).
Für den FBP- und DHAP-Gehalt findet man dagegen ein inverses
Verhalten. FBP und die Triosephosphate (DHAP, GAP) stehen über die
Reaktionen von Aldolase und Triosephospha­tisomerase weitestgehend im
Gleichgewicht, wobei die Gleichgewichtslage stark durch die stromale
DHAP-Konzentration beeinflußt wird (Edwards & Walker 1983). Daher sind
die Effektor-induzierten Veränderungen in der DHAP-Konzentration im
Vergleich zum FBP-Ge­halt verschieden, obwohl beide Spiegel qualitativ
gleiche Änderungen aufweisen. Nach Zu­gabe der schwächeren Akzeptoren
war eine DHAP- und FBP-Zunahme auf 130-135% und nach Zugabe von Nitrit
plus OAA auf 130% (DHAP) und 170% (FBP) der Kontrolle zu ver­zeichnen.
Die Zugabe von 2 mM Nitrit und 10 µM Methylviologen bewirkte dagegen
einen Anstieg von FBP auf 300% und von DHAP auf 170% des
Kontrollwertes. Unter den zuletzt aufgeführten Bedingungen trat
parallel zum stark erhöhten FBP-Gehalt eine extreme Abnahme des
FBPase-Aktivierungszustandes auf (vgl. Abb. 13C und 13D).
Die Effekte der zusätzlichen Akzeptoren werden unter Berücksichtigung
des DHAP/PGA-Verhältnisses deutlicher. Dies betrug unter
Kontrollbedingungen 0,05, wurde durch Behand­lung mit den schwächeren
Akzeptoren nahezu verdoppelt (0,11) und stieg auf das 10fache und mehr
bei 2 mM Nitrit (0,48) und 10 µM Methylviologen (0,68) an.
3.2 Herstellung und Charakterisierung von Fd I-„sense“- und
-„antisense“-Kartoffelpflanzen
3.2.1 Identifizierung von fed 1-cDNA-Sequenzen aus Kartoffel
Für die Konstruktion transgener Kartoffelpflanzen mit einem
reduzierten endogenen Protein­gehalt an Fd I erfolgte die
Identifizierung und Isolierung des homologen cDNA-Klons aus einer in -Zap
konstruierten Kartoffelblatt-cDNA-Bank (freundlicherweise von Dr. U.
Sonnewald, Gatersleben, zur Verfügung gestellt).
Zur Identifizierung des Kartoffel-cDNA-Klons sollten zunächst
Teilsequenzen mittels PCR amplifiziert werden, die dann nach
Markierung mit DIG-Nukleotiden zum „Screenen“ einer
Kar­toffelblatt-cDNA-Bank genutzt werden können. Der Einsatz einer
homologen Sonde er­schien wesentlich erfolgversprechender, da auf
Nukleotidebene ein Sequenzvergleich bekann­ter fed 1-Sequenzen, wie
z.B aus A. thaliana und Pisum sativum mit dem vorliegen­den Klon aus
Spinacia oleracea (freundlicherweise überlassen von N. Wedel,
Universität Kiel), nur eine Iden­tität zwischen 57% und 69% ergab (je
nach Wahl der Spanne der einzu­schiebenden Platzhalter).
So wurde aus für sechs Stunden belichteten Kartoffelblättern poly(A)+-RNA
isoliert und unter Verwen­dung von reverser Transkriptase
einzelsträngige cDNA hergestellt (s. Kap. 2.17 und Kap. 2.18). Von der
Präparation wurden dann etwa 100 ng als Matrize in eine
Standard-PCR-Reaktion, mit 40 °C als optimierter
„annealing“-Temperatur, eingesetzt. Die Basenfolge, der in dieser
Re­aktion verwendeten degenerierten Oligonukleotide Fd „sense” (32mer,
Sinnstrang) und Fd „antisense” (29mer, Gegenstrang) (s. Kap. 2.15),
wurde aus konservierten Bereichen mit mög­lichst hohem G/C-Gehalt von
schon bekannten fed 1-Nukleotidsequenzen abgeleitet. Diese
PCR-Reaktionen führten zur Amplifikation eines 189 bp-Fragmentes,
welches nach Klonierung in den Vektor pBSK in XL1-blue-Zellen vermehrt
und einer doppelsträngigen Sequenzanalyse unterzo­gen wurde. Die hohe
Identität von 81% für die abgeleitete Aminosäu­resequenz des
erhaltenen Fragmentes mit der Sequenz aus Spinat bestätigte die
Annahme, daß das Amplifikat für eine Teil­sequenz des Kartoffelgens
kodiert. Die Analyse der cDNA-Expres­sionsbibliothek aus
Kartoffel­blatt (s. Kap. 2.22) erfolgte mit einem in PCR-Reaktionen
mit DIG-markierten Fragment (s. Kap. 2.20). Auf diese Weise konnten
nach einem Vereinzelungs­schritt vier positive Klone identifiziert
werden, die nach in vivo Exzision (s. Kap. 2.23) als Plasmide in E.
coli vermehrt und nachfolgend sequenziert wurden.
3.2.2 Sequenzanalyse der isolierten fed 1-cDNA-Klone aus Kartoffel
Die als NotI-Fragmente aus pBSK gewonnenen und über ein Agarosegel
analysierten vier positi­ven Klone wiesen eine leichte Varianz in der
Länge (500-600 bp) auf. Nach Sequenz­analyse zeigten sich alle
cDNA-Fragmente in der Nukleotidfolge als identisch, wobei aber nur ein
Klon für die vollständige Sequenz (reifes Protein plus Transitpeptid)
kodierte. Die anderen drei Klone besaßen einen N-terminal
unvollständigen Bereich. Die cDNA-Sequenz des längs­ten Klons (575
bp), mit einem offenen Leserahmen von 435 Nukleotiden und einem
Stop­kodon an Nukleotidposition 432, ist in Abbildung 14 dargestellt.
Als Initiationskodon für den Start der Translation wurde das dem
5’-Ende des cDNA-Klons am nächsten liegende ATG (Beginn mit
Nukleotidposition 5) angenommen. Die Umgebung dieses Kodons mit der
Basen­folge AAAAATGGC stimmt mit dem für viele pflanzliche mRNAs
gefun­denen Konsensus-Motiv eines starken Startkodons überein, bei
welchem sich relativ zum Adenin des ATG in Nukleotidposition -3
meistens eine Purinbase (A oder G) und in Posi­tion +4 typischerweise
eine Guaninbase befindet (Lütcke et al. 1987; Kozak 1989).
Unter­stützt wird diese Annahme weiterhin von dem Befund, daß ein
Großteil der chloroplastidär lokalisierten Proteine mit den
Aminosäureresten Met-Ala beginnen (Gavel et al. 1990; von Heijne et al. 1989).
Die abgeleitete Aminosäuresequenz ergibt somit ein Polypeptid von 144
Aminosäureresten (s. Abb. 14), wobei höchstwahrscheinlich die 46
N-terminalen Aminosäuren für ein chloro­plasti­däres Transitpeptid
kodieren. Diese Präsequenz wird während bzw. kurz nach dem Transport
des Pro­teins über die Chloroplastenhüllmembran ins Stroma der
Plastiden proteoly­tisch vom reifen Protein abgespalten (Cashmore et al. 1985,
Schmidt et al. 1986). Für einen großen Anteil von
Translationsprodukten kernkodierter, aber chloroplastidär
lokalisierter Pro­teine konnten Gavel & von Heijne (1990) aus
Sequenzvergleichen für die Prozessierungs­stelle ein locker
kon­serviertes Konsensus-Motiv der Aminosäurefolge
(Val/Ile)-X-(Ala/Ser/Cys)(Ala/Ser/Cys/Met) nachweisen. Bei 60% der
analysierten Sequenzen steht, relativ zur Pro­zessierungsstelle, an
Aminosäureposi­tion -3 ein Isoleucin bzw. Valin, an Position -1 häufig
ein Cystein (20%) und ein Alanin an Position -1 und/oder +1 (45%).
Zusätzlich ist im Bereich zwischen Aminosäureposition -10 bis -6 und
auch oft an Position -2 ein Arginin-Rest lokali­siert. Diese
Arg-...-(Ile/Val)-Abfolge im Be­reich des Prozessierungs-Motivs
be­sitzt ein hohes Potential zur Ausbildung einer amphiphilen -Faltblatt-Struktur,
die vermutlich an der Interaktion mit der stromalen Protease beteiligt
ist (von Heijne et al. 1989, Franzen et al. 1990). Mit diesem Motiv
stimmten 30% der ausgewählten Präproteine überein, woraus die Autoren
folgerten, daß bei Auftreten dieser Sequenz mit 90%iger Sicherheit die
korrekte Spaltstelle vorhergesagt werden kann.
-4 AAAAATGGCTAGTATTTCTGGTACCATGATTAGCACTTCTTTCCTGCCAAGAAAGCCAGT
M A S I S G T M I S T S F L P R K P V +19
+57 TGTGACTAGCCTCAAAGCCATATCAAATGTTGGTGAAGCTCTTTTTGGTCTTAAATCTGG
V T S L K A I S N V G E A L F G L K S G +39
+117 TAGAAATGGGAGGATTACTTGCATGGCCAGTTACAAAGTGAAGCTTATTACACCAGATGG
R N G R I T C M A S Y K V K L I T P D G +59
+177 ACCTATTGAATTTGAATGCCCAGATGATGTCTACATTCTTGACCAAGCTGAGGAAGAAGG
P I E F E C P D D V Y I L D Q A E E E G +79
+235 ACATGATCTTCCTTACTCATGCAGGGCTGGTTCTTGCTCATCTTGTGCTGGAAAAGTTAC
H D L P Y S C R A G S C S S C A G K V T +99
+297 TGCTGGAACTGTTGATCAGTCTGATGGAAAGTTCCTTGATGATGACCAAGAAGCTGCAGG
A G T V D Q S D G K F L D D D Q E A A G +119
+357 ATTTGTGCTCACTTGTGTTGCTTACCCAAAGTGTCATGTTACCATTGAGACTCACAAGGA
F V L T C V A Y P K C D V T I E T H K E +139
+417 GGAGGAGCTTACTGATTAAACTTCAACCATTTCCATTTAAATAAAAACAACACTTCATTT
E E L T A  +144
+477 TGTTTCATGAGCATTTACTTTTCATATGTAACTTCTTTTTTTCCCTCTTTTGTTATCACA
+537 AAAGTTGCTATCTAGCTCTTTTAAGTCAATCATTT
Abbildung 14: Nukleotidsequenz und abgeleitete Aminosäuresequenz des
für Fd I kodierenden cDNA-Klons aus Kartoffel.
Die Nukleotidpositionen sind links und die Aminosäurepositionen sind
rechts vermerkt. Der Translationsstart und das Stopkodon sind fett
gedruckt. Der vertikale Pfeil kennzeichnet die Prozessierungsstelle.
Ein mutmaß­liches Polyadenylierungssignal und die Cystein-Reste, die
an der Bildung des [2Fe2S]-Zentrums beteiligt sind (Fukuyama et al.
1980), sind unterstrichen. 5’- und 3’-untranslatierte Bereiche sind
kursiv dargestellt.
Der Vergleich der abge­leiteten Aminosäure­sequenz des Kartoffelklons
mit anderen bekannten Fd-Sequenzen (s. Abb. 15) verdeutlicht den von
Gavel & von Heijne (1990) für die aus Silene pratensis isolierte
Fd-cDNA-Sequenz (Smeekens et al. 1985) diskutierten Befund, daß das
Konsensus-Motiv für die Prozessierung eventuell um eine Aminosäure
verschoben ist. Die Spaltung würde somit zwischen dem Cystein in
Position 46 und dem Methionin in Position 47 erfolgen. Endständige
Methionin-Reste plastidenimportierter Enzyme werden normalerweise
abgespalten (Ikeuchi et al. 1989, Webber et al. 1989, Michel et al. 1988,
Flinta et al. 1986), so daß im Fall von Fd das Methio­nin vermutlich
nach initialer Spaltung am Konsensus-Motiv durch eine stromale
Methio­nyl-Aminopeptidase entfernt wird (Gavel & von Heijne 1989).
Sämtliche auf Protein­ebene analysierten Fd I-Sequenzen der reifen
Proteine, wie z.B. die aus Tomate (Kamide et al. 1995, s. Abb. 15),
besitzen in Aminosäureposition 1 ein Alanin, welches auch für die
abgeleiteten cDNA-Sequenzen (Ref. s. Abb. 15) propagiert wurde. Das
reife Kartoffel-Fd I-Polypeptid setzt sich demnach aus 97 Aminosäuren
zusammen.

A: Transitpeptide
Kartoffel I ---MAS---ISGTMISTSFLPRKPVVTSLKAIS-NVGEALFGLKSG--RNGRITC-
46
Tomate I ---MAS---ISGTMISTSFLPRKPAVTSLKAIS-NVGEALFGLKSG--RNGRITC- 46
A. thaliana I ---MAST-ALSSAIVGTSFIRRSPAPISLRSLPSANTQSLFGLKSGTARGGRVTA-
51
Spinat I ---MAAT-TTTMMGMATTFVPKPQAPPMMAALPSNTGRSLFGLKTG-SRGGRMT-- 49
Erbse I ---MATTPALYGTAVSTSFLRTQPMPMSVTTTK-AFSNGFLGLKTSLKRGDLAVA- 51
Mais I MATVLGSPRAPAFFFSSSSLRAAPAPTAVALPA--AKVGIMGRSAS--SRRRLRA- 51
Mais II ---------MAATALSMSILR-APPPCFSSPLR--LRVAVAKPLAAPMRRQLLRAQ 44
Mais III ---MSTSTFATSCTLLGNVRTTQASQTAVKSPS---SLSFFSQVTKVPSLKTSKKL 50
. . .. :
B: Reife Proteine
Kartoffel I MASYKVKLITPDGP-IEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQ
59
Tomate I MASYKVKLITPEGP-IEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQ
59
Tomate II -ATYKVKLITPEGP-FEFDCPDDVSILDRAEETGLDLPYSCRAGACSSCAGKVTAGSVDQ
58
Erbse I MASYKVKLVTPDGT-QEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQ
59
Spinat I MAAYKVTLVTPTGN-VEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQ
59
Spinat II -ATYKVTLVTPSGS-QVIECGDDEYILDAAEEKGMDLPYSCRAGACSSCAGKVTSGSVDQ
58
Mais I QATYNVKLITPEGE-VELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQ 59
Mais II -ATYNVKLITPEGE-VELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQ
58
A. thaliana I MATYKVKFITPEGE-LEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQ
59
Mais III MAVYKVKLVGPEGEEHEFDAPDDAYILDAAETAGVELPYSCRAGACSTCAGKIESGSVDQ
60
* *:*.:: * * .: .* :** ** * :**:*****:**:****: * ::*
Kartoffel I SDGKFLDDDQEAAGFVLTCVAYPKCDVTIETHKEEELTA- 98
Tomate I SDGNFLDEDQEAAGFVLTCVAYPKGDVTIETHKEEELTA- 98
Tomate II SDNSFLDDDQIDEGFVLTCVAYPKSNVTIETHKEEDLVG- 97
Erbse I SDGSFLDDEQIEAGFVLTCVAYPTSDVVIETHKEEDLTA- 98
Spinat I DDQSFLDDDQIDEGWVLTCAAYPVSDVTIETHKEEELTA- 98
Spinat II SDQSFLEDGQMEEGWVLTCIAYPTGDVTIETHKEEELTA- 97
Mais I SDQSYLDDGQIADGWVLTCHAYPTSDVVIETHKEEELTGA 99
Mais II SDQSFLNDNQVADGWVLTCAAYPTSDVVIETHKEDDLL-- 96
A. thaliana I SDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDIV-- 97
Mais III SDGSFLDDGQQEEGYVLTCVSYPKSDCVIHTHKEGDLY-- 98
.* .:*:: * *:**** :** : .*.**** ::
Abbildung 15: Aminosäuresequenzvergleich von verschiedenen Fd.
Die abgeleitete Aminosäuresequenz aus Solanum tuberosum L. (Kartoffel,
diese Arbeit) wurde mit den Blatt-Fd I-Sequenzen aus Lycopersicon
esculentum. (Tomate I, John et al. 1997; Tomate II, Kamide et al. 1995),
Arabi­dopsis thaliana (A. thaliana I, Somers et al. 1990), Spinacia
oleracea (Spinat I, Wedel et al. 1988), Pisum sativum (Erbse I,
Dobres et al. 1987), Zea mays (Mais I und II, Hase et al. 1991), den
Blatt-Fd II-Sequenzen aus Spinacia oleracea (Spinat II, Takahashi et al. 1983)
und dem Wurzel-Fd III aus Zea mays (Mais III, Wur­zel, Hase et al. 1991)
verglichen. In sämtlichen Fd sind identische Aminosäuren durch Sterne,
hochkonservierte Aminosäuren durch Doppelpunkte und konservierte
Aminosäuren durch einfache Punkte gekennzeichnet. Lücken, die durch
den Prozess der computergestützten Analysen entstanden, sind durch
Bindestriche dargestellt (Programm: ClustalW, s. Kap. 2.30). A:
Sequenzvergleich der Fd-Transitpeptide. Die Präsequenz aus Tomate II
und Spinat II wurde bis jetzt nicht ermittelt. B: „Alignment“ der
reifen Fd-Proteine. Außer den aus Tomate und Spinat isolierten Fd
II-Sequenzen, die über Proteinsequenzierung be­stimmt wurden, wurden
sämtliche dargestellte Sequenzen von cDNA- oder von genomischen Klonen
abge­leitet.
Weitere charakteristische Merkmale in der Zusammensetzung
chloroplastidärer Transitpeptide, die eine eher positive Gesamtladung
aufweisen, sind das begrenzte Vorkommen geladener Aminosäuren, wie
Asparagin und Glutamin, sowie ein hoher Anteil der Hydroxyaminosäuren
Serin und Threonin (De Boer & Weisbeek 1991, von Heijne et al. 1989).
In der Tran­sit­sequenz des isolierten Kartoffelklons kommt mit
Ausnahme eines Glutaminsäure-Restes keine negativ geladene Aminosäure
vor, wobei der Serin/Threonin-Anteil bei 23% liegt.
Die abgeleitete Aminosäuresequenz des isolierten Kartoffelklons
besitzt eine sehr hohe Iden­tität (72%-95%) im Vergleich zu anderen
bekannten Fd I-Sequenzen aus Blatt, die entweder auf Protein­ebene
oder nach Genisolierung bestimmt wurden (s. Abb. 15 und Tab. 4). Der
Sequenz-vergleich dem mit Isoprotein Fd III aus nicht-photosynthetisch
aktiven Organen, wie z.B. Mais-Wurzeln (Kimata & Hase 1989), ergab nur
eine Identität von 64%. Dies untermau­ert stark die Annahme, daß die
in dieser Arbeit isolierte Sequenz für ein im Blatt lokalisiertes Fd
kodiert. Der Sequenzver­gleich mit dem ebenfalls im Chloroplasten
vorkommenden Fd II aus Tomate (einer Pflanze der­selben Familie) zeigt
nur eine Identität von 79% im Gegensatz zu 95%, die beim Ver­gleich
der Kartoffel-Sequenz mit Fd I aus Tomate gefunden wurde. Ein
ebenfalls sehr viel geringerer Wert ergab sich beim Vergleich der
Fd I-und Fd II-Sequenzen aus Tomate (80%) und Spinat (74%), so daß die
isolierte Sequenz mit hoher Wahrscheinlich­keit eine für Fd I
kodierende cDNA darstellt. Ein weiteres Argument dafür ist die 97%ige
Identität zwischen dem Fd I-Transitpeptid aus Kar­toffel und dem
Transitpeptid aus Tomate (s. Tab. 4).
Tabelle 4: Prozentuale Identität einiger bekannter
Fd-Aminosäuresequenzen in Bezug auf die abgelei­tete Kartoffelsequenz.
Die Berechnung der Werte für die Präproteine, die reifen Proteine und
die Transitsequenzen, erfolgte mit Hilfe des Programms „LALIGN“ (s.
Kap. 2.30). I: Fd I, II: Fd II, III: Fd III; Referenzen: s. Abb. 15.
Präprotein
reifes
Protein
Transit-
Peptid
Kartoffel
100
100
100
Tomate I
96
95
97
Tomate II
-
79
-
A. thaliana I
62
72
43
Spinat I
64
75
42
Spinat II
-
71
-
Erbse I
64
82
29
Mais I
66
74
21
Mais II
39
69
20
Mais III
43
64
10
3.2.3 Konstruktion transgener Kartoffelpflanzen mit erhöhten bzw.
erniedrigten endogenen Gehalten an Fd I
Generell sollte die in Pflanzen eingebrachte „antisense“-RNA die
Akkumulation der Ziel-RNA verhindern, indem die auf diese Weise
gebildeten „sense:antisense“-mRNA-Duplexe einer sehr schnellen
Degradierung durch nukleäre RNasen unterliegen (zusammengefaßt in
Rodermel & Bogorad 1992). Konsequenterweise ist die Chance einer
erfolgreichen Repri­mierung des endo­genen Proteinniveaus in einem
„antisense“-Experiment bei Verwendung von homologen Zielgen-Sequenzen
wesentlich größer als im heterologen System. Beim Vergleich der fed 1-Nukleotidse­quenzen
des in dieser Arbeit isolierten Kartoffel-cDNA-Klons mit dem von N.
Wedel zur Verfü­gung gestellten cDNA-Klon aus Spinat ergab sich eine
Identität von 74% (reifes Protein; s. Tab. 4). Desweiteren bilden fed-Gene
in höheren Pflanzen eine „Genfa­milie“ (Hase et al. 1991), deren
Mitglieder in licht- und gewebespezifischer Art und Weise exprimiert
werden.
Die Transformation von Wildtyp-Kartoffel erfolgte mit einem homologen
für Fd I kodierenden „antisense“-Konstrukt. Dieser An­satz bietet hohe
Sicherheit, daß keine Effekte auf die Expres­sionsniveaus der anderen
Fd erfolgen. Sonst könnten Fd-abhängige Reaktionen in anderen Geweben
beeinflußt werden. Da das „antisense“-Konstrukt unter Kontrolle des
kon­stitutiven „Cauliflower Mosaik Virus“-35S-Promoter (CaMV35S)
gestellt wurde, sollte zu dem eine lichtunabhängige Expression
garantiert sein.
Für die Überexpression von fed 1 nach „sense“-orientierter Integration
in das Kartoffelgenom wurde ein heterologer Ansatz gewählt, d.h. der
A. tumefaciens vermittelte Gen­trans­fer er­folgte mit einer
artfremden, für Fd I kodierenden cDNA. Hierzu wurde der von Dr. N.
Wedel (Univer-sität Kiel) freundlicherweise überlassene cDNA-Klon aus
Spinat unter Kon­trolle des CaMV35S-Promoters in Leserichtung in den
binären Vektor pDE1001 inseriert (s. Kap. 2.27). Dadurch sollte die
Häufigkeit von extremen Cosuppressionseffekten, die auf Paarung
homo­loger DNA-Sequenzbereiche beruht und letztendlich zu einer
Verringerung der Transkrip­tionsrate beider Gene (d.h. des endogenen
und des Transgens) führt (Nellen & Lichtenstein 1993), herab-gesetzt
werden.
Die primäre Selektion von Fd I-über- und -unterexprimierenden
transgenen Pflanzen nach Re­gene­ration erfolgte über „Western
Blot“-Analyse. Diese Ergebnisse wurden an aus Knollen gezoge­nen,
ausgewählten transgenen Linien verifiziert. Sämtliche weiterführenden
Experi­mente wurden ebenfalls an aus Knollen gezogenen Pflanzen
durchgeführt. Der Grund dafür liegt in den von Masle et al. (1993)
beschriebenen somatischen Variationen, d.h. der Ausbil­dung diverser
Phä­notypen, die oft auf die Regeneration von Pflanzen aus
undifferenziertem Kallusgewebe in Gewe­bekultur und nicht auf die
Integration der transformierten Gen­konstrukte zurückzuführen sind.
3.2.4 Molekulare Analyse von Fd I-überexprimierenden Kartoffelpflanzen
Von 55 primär getesteten, unabhängigen transgenen Linien, die mit dem
„sense“-Konstrukt trans­formiert wurden (im Weiteren als Fd S
bezeichnet), zeigten 14 Pflanzen auf Proteinebene eine zwei- bis
dreifache Überexpression im Vergleich zu Wildtyp-Pflanzen, equivalent
zu 25% der insgesamt untersuchten primären Transformanten. Das nach
immunologischer Detektion be­stimmte Signal mit einem apparenten
Molekulargewicht von 18 kDa deutet daraufhin, daß die fed 1-Genprodukte
transkribiert, translatiert und nach Import in das Chloroplastenstroma
korrekt pro­zessiert wurden (s. Abb. 16).
Blatt



(kDa)
S119 A150 A99 WT S138 A62 MW
Abbildung 16: „Western Blot“-Analyse der endogenen Fd I-Gehalte in
Blattextrakten transgener „sense“- und „antisense“-Kartoffelpflanzen
im Vergleich zu Wildtyp-Pflanzen.
Gleiche Mengen an löslichem Protein (100 µg/Spur) wurden in einem
20%igen diskontinuierlichen SDS-Poly­acrylamid-Gel elektrophoretisch
aufgetrennt und mittels Elektrophorese auf Nitrozellulose-Membranen
über­führt. Die Immundetektion erfolgte mit einem Antikörper gegen
Fd I aus Spinat. Die Nummern der transgenen Linien sind oben vermerkt,
die molekularen Massen des SIGMA VII L-Standards sind rechts
verzeichnet: BSA (66 kDa); Ovalbumin (45 kDa);
Glyceraldehyd-3-Phosphat-Dehydrogenase (36 kDa); Carboanhydrase (29
kDa), Trypsinogen (24 kDa), Trypsin-Inhibitor (20,1 kDa),
alpha-Lactalbumin (14,2 kDa). Der Pfeil links zeigt das Signal von
Fd I an.
Um nähere Informationen über die fed 1-Expressionsniveaus zu erhalten,
erfolgte die Reini­gung von Gesamt-RNA aus vier bis sechs Stunden
belichteten Blättern von transgenen Wild­typ-Kartof­fel- und
Spinatpflanzen. Die RNA-Blots wurden sowohl mit dem 32P-markierten
cDNA-Fragment aus Kartoffel als auch mit dem aus Spinat hybridisiert.
Selbst unter wenig stringenten Waschbe­dingungen (2 x SSC;
s. Abb. 17A) wurde keine Kreuzreaktion zwischen der markierten fed 1-Sonde
und der Spinat-Fd-mRNA, und umgekehrt, gefunden. Somit ist eine klare
Unter­scheidung zwischen dem endogenen fed 1-Transkript und der
heterologen mRNA möglich. Unter­schiede im endogenen fed 1-mRNA-Gehalt
wurden somit erst nach Inkubation der Blots mit der radioaktiv
markierten Spinat-Sonde deutlich (s. Abb. 17B, oben). Die transgenen
Linien S119 und S138 wiesen im Vergleich zu den
Wildtyp-Kartoffelpflanzen einen um 50 % erhöhten fed 1-mRNA-Gehalt
auf, während die Tansformanten S125 und S156 eine geringere Expression
der eingeführten Spinat-fed 1-cDNA von 10% bzw. 20% zeigten. Bei allen
getesteten transgenen Pflanzen blieb der endogene Gehalt an Kartoffel
fed 1-mRNA stabil (s. Abb. 17B, unten). Die auf mRNA-Ebene gefundenen
Unterschiede in der fed 1-Expression waren auf Proteinebene,
insbesondere in den Pflanzen mit stark erhöhter fed 1-mRNA-Expression,
wesentlich deutlicher ausgeprägt. Diese Pflanzen (z. B. S119, S138)
wie­sen eine Fd I-Proteinmenge auf, die 100% bis 200% über der in
Wildtyp-Pflanzen detektierten lag (s. Abb. 16). Unter sämtlichen
analysierten Pflanzen wurde keine Transformante identifi­ziert, die
Cosuppression des endogenen fed 1-Gens zeigte.
3.2.5 Molekulare Analyse von Fd I-unterexprimierenden
Kartoffelpflanzen
Bei der primären Selektion zeigten von 47 unabhängigen
„antisense“-Linien (weiterhin als Fd A bezeichnet), der über „Western
Blot”-Analyse mehrfach getesteten Pflanzen, 43 der transgenen,
regnerierten Pflanzen eine deutliche Reduktion des Fd
I-Proteingehaltes von etwa 50% im Ver­gleich zu den parallel
getesteten Wildtyp-Kartof­felpflanzen (s. Abb. 16). Dies entspricht
einem Prozentsatz von 91,5% bezüglich der insgesamt analysierten
Pflanzen. Diese hohe Zahl von Pflanzen mit erfolgreicher Reduktion des
endogenen Fd I-Proteingehaltes nach Einführung des
„antisense“-Konstruktes konnte auch auf Ebene der fed 1-mRNA-Expression
bestätigt werden.
In der „Northern Blot”-Analyse zeigten von 25 zufällig ausgewählten
transgenen „antisense“-Pflanzen nur zwei transgene Linien eine mit
Wildtyp-Pflanzen vergleichbare Anzahl von fed 1-Transkripten,
entsprechend 8% der getesteten Pflanzen (Daten nicht gezeigt). In den
transge­nen Fd-Linien A62, A93, A99, A100 und A150, die für
weiterführende Experimente ausge­wählt wur­den, variierte das
Transkriptniveau zwischen 5%-10% der in Wildtyp-Pflanzen
detektierbaren Menge an fed 1-mRNA (s. Abb. 17B unten). In Hinsicht
auf die überexprimie­renden Kartoffelpflanzen wiesen die
Unterexprimierer somit ebenfalls eine offensichtliche Diskrepanz
zwischen dem fed 1-Transkriptniveau und der letztendlich detektierten
Fd I-Proteinmenge auf, d.h. es scheint keine direkte Korrelation
zwischen der Transkriptmenge und der Menge an translatiertem, reifem
Protein zu geben. Dies deutet auf einen posttranskriptio­nalen
Regulationsmechanismus hin, der eventuell auf unterschiedlicher mRNA-
und/oder (Prä)protein-Stabilität beruht. Als weitere Mög­lichkeit kann
auch ein regulatorisches Element, das auf Translationsebene greift, in
Betracht ge­zogen werden.
Auf RNA-Blots mit Kartoffelblattproben zeigten sämtliche
Transformanten nach Hybridisierung mit dem 32P-markierten fed 1-cDNA-Fragment
aus Kartoffel zwei diskrete Banden mit einer Länge von etwa 760 bp und
ca. 1000 bp. Im Gegensatz dazu wurde in Wildtyp-Kartoffelpflan­zen nur
das kleinere Transkript detektiert. Eine Länge von 760 bp stimmt mit
den Ergebnissen überein, die für die fed 1-Transkripte aus
Maisblättern (700-800 bp; Hase et al. 1991) und aus Erbsenblättern
(800 bp; Dobres et al. 1987) beschrieben sind. Ein Transkript mit
einer Länge von 900-1000 bp wurde für das nicht photosynthetisch
aktive Fd III aus Maiskeimlingen (Hase et al. 1991) und eine
Nitrat-induzierbare Fd-Isoform (Fd IV) aus Maiswurzeln beschrie­ben (Matsumara et al. 1997).
In diesen Fällen wurde aber keine Kreuzreaktion mit dem 32P-markierten
fed 1-Klon gefunden.
Blatt
A WT-Spinat WT-Kartoffel
32P-Spinat
30 15 30 15 (µg)

32P-Kartoffel

Sonde

Konstrukt „antisense“-Kartoffel „sense“-Spinat

B

WT-
Kar-
toffel
A62 A93 A99 A100 A150 S119 S125 S138 S156

Sonde
32P-Spinat



32P-Kartoffel
Abbildung 17: „Northern Blot“-Analyse der fed 1-Expression in Blättern
von Kartoffel- und Spinat-Wildtyp-Pflanzen im Ver­gleich zu transgenen
Kartoffelpflanzen.
Gesamt-RNA (A: 15 oder 30 µg/Spur; B: 30 µg/Spur) von Spinat- bzw.
Kartoffel-Kontrollpflanzen und aus­ge­wählten transgenen Linien der
Fd I-über- bzw. -unterexprimierenden Kartoffelpflanzen wurde in
denaturie­renden Agar­osegelen aufgetrennt und auf Nylonmembranen
transferiert. Die Hybridisierung erfolgte zu­nächst mit dem 32P-markierten
fed 1-cDNA-Fragment aus Spinat. Nach Entfernen der Sonde wurde eine
Rehybridisierung mit dem 32P-markierten Kartoffel-fed 1-cDNA-Fragment
durchgeführt. Die Proben wurden nach vier bis sechs Stunden Belichtung
, d.h. unter „steady state“-Bedingungen, genommen. A: Detektion von
fed 1-mRNA in Spinat und Kartoffelblät­tern B: Transkriptniveau von
fed 1 in transformierten und Wildtyp-Kartoffelpflanzen. Die Nummern
der ausge­wählten transgenen „antisense“-Linien sind links oben und
die „sense“-Linien rechts oben angegeben.
3.2.6 Bestimmung von Fd I-Protein- und -mRNA-Mengen in Knollen und
Wurzeln von transgenen und Wildtyp-Kartoffelpflanzen
Bis jetzt sind mindestens sechs Fd-Isoproteine aus verschiedenen
grünen und nicht-grünen, plastidenhaltigen Geweben beschrieben worden
(vgl. Kap. 1.2). Für Kartoffelpflanzen waren bisher noch keine Daten
verfügbar. Da Fd als Elektronendonatoren in wichtigen,
physiologi­schen Reaktio­nen agieren, ist es notwendig nach
Transformation von Pflanzen mit dem fed 1-Gen eventu­elle Änderungen
im Fd I-Proteingehalt in den verschiedenen plastidenhaltigen
Pflanzenteilen zu untersuchen. Dazu wurden sowohl „Western Blot“- als
auch „Northern Blot“-Analysen von Kartoffelknol­len und Wurzeln
durchgeführt.
Wurzel

Konstrukt „antisense“-Kartoffel“ „sense“-Spinat

WT-
Kar-
toffel

WT-

A150 A62 A100 A99 A93 S119 S125 S156 Spinat
Sonde


32P-Spinat


32P-Kartoffel

Abbildung 18: „Northern Blot“-Analyse der fed 1-mRNA Expressionshöhe
in Wurzelextrakten von Fd I-über- und -unterexprimierenden
Kartoffelpflanzen im Vergleich zu Kartoffel- und
Spinat-Wildtyp-Pflanzen.
Die Experimente wurden wie unter Abbildung 17 beschrieben
durchgeführt. Die Markierung erfolgte wie jeweils am rechten Rand
vermerkt mit 32P-markierten fed 1-cDNA-Fragmenten aus Spinat bzw.
Kartoffel. Ausgewählte transgene Linien sind wie oben angezeigt: Fd
A62, A93, A99, A100 („antisense“) und Fd S119, S125, S156 („sense“).
WT: Wildtyp
In Wurzelextrakten von Kartoffelkontrollpflanzen konnte nach
Anfertigung von „Western Blots“ kein Fd-Signal detektiert werden,
während in Spinat-Wurzelextrakten ein Protein mit einem appa­renten
Molekulargewicht zwischen 20 kDa und 22 kDa markiert wurde. Bei
ent­sprechenden „Immunprints“ mit Wurzelextrakten der selektierten Fd
I-über- und -unterexpri­mierenden transge­nen Linien wurden ebenfalls
keine Signale gefunden (Daten nicht gezeigt). Im Fall der
Über­exprimierer, die mit dem Spinat-fed 1-Gen transformiert wurden,
sollte eine Expression des eingebrachten fed 1-Gens auf Proteinebene
im Wurzelgewebe jedoch detek­tierbar sein, da für den Nachweis der
diesem Gen homologe Antikörper aus Spinat eingesetzt wurde.
Auf RNA-Ebene wurden in Wurzeln aller untersuchten Überexprimierer,
nach Inkubation mit der 32P-markierten Spinat-cDNA, zwei diskrete
Banden mit einer Länge von etwa 600 bp und 900 bp markiert. Dage­gen
wurde weder in den Wurzeln von Kontrollpflanzen (Spinat und Kartoffel)
noch in denen von Unterexprimierern ein Transkript markiert. Nach
Re-Hybridisierung der gleichen Blots mit der 32P-markierten
Kartoffel-cDNA wurde auf den Autoradiogrammen nur für die
„antisense“-Pflanzen ein starkes Signal auf Höhe von etwa 900 bp
beobachtet. Eine Ausnahme bildete die transgene Linie A99, die keine
Markierung zeigte (s. Abb. 18, unten). Dieser Befund deutet wiederum
auf eine Veränderung des fed-Expressionsmusters in den Transformanten
hin.
Knollenextrakte von Über- und Unterexprimierern und Kontrollen zeigten
nach „Western-blotting“ und „Immunprinting“ nur eine sehr schwache
Bande mit einem apparenten Moleku­largewicht von 18 kDa (s. Abb. 19).
Somit konnte in diesem Gewebe weder für die „sense“- noch für die
„antisense“-Pflanzen eine Veränderung im Fd I-Gehalt nachgewiesen
werden.

A63 A99 A100 A150 WT S119 S125 S138 S156 MW
(kDa)
Abbildung 19: „Western Blot“-Analyse der endogenen Fd I-Gehalte in
Knollenextrakten transgener „sense“- und „antisense“-
Kartoffelpflanzen im Vergleich zu Wildtyp-Kartoffelpflanzen.
Gleiche Mengen an löslichem Protein (100 µg/Spur) wurden in einem
20%igen diskontinuierlichem SDS-Poly­acrylamid-Gel aufgetrennt und
nach der Elektrophorese auf Nitrozellulose-Membranen überführt. Die
Immun­detektion erfolgte mit einem Antikörper gegen Fd I aus Spinat.
Transgene Linien sind oben vermerkt, moleku­lare Massen des
Proteinstandards (in kDa) sind rechts verzeichnet (vgl. Abb. 16).
„Northern Blot“-Analysen, die mit aus Knollen von transgenen „sense“-,
„antisense“- und Kon­trollpflanzen isolierter Gesamt-RNA durchgeführt
wurden, ergaben in allen Fällen nach Hybridi­sierung mit dem
markierten Kartoffel cDNA-Klon ein Signal in der Länge von etwa 850 bp
(s. Abb. 20, unten). Dies deutet darauf hin, daß in Knollen eine
endogene fed 1-mRNA exprimiert wird, die eine hohe Homologie zu der
fed 1-mRNA aus Blättern aufweist. Die Pro­ben der „anti­sense“ Knollen
wiesen zusätzlich ein Transkript auf, welches um etwa 250 bp länger
ist (1100 bp). Diese Differenz ist vergleichbar mit den nach Analyse
von Blatt- und Wurzelextrakten er­haltenen Ergebnissen, so daß
vermutlich auch in Knollen dieses größere Transkript der Expres­sion
des eingeführten Genkonstrukts zuzuschreiben ist. Demgegenüber wurde
mit der 32P-mar­kierten fed 1-cDNA aus Spinat nur das 850 bp lange
Fragment detektiert (s. Abb. 20, oben).
Knolle

Konstrukt „antisense“-Kartoffel „sense“-Spinat

WT-
Kar-
toffel
A62 A93 A99 A100 S119 S125 S156
Sonde


32P-Spinat

32P-Kartoffel

Abbildung 20: „Northern Blot“-Analyse der fed 1-mRNA Expression in
Knollenextrakten von Fd I-über- und -unterexprimierenden
Kartoffelpflanzen im Vergleich zu Wildtyp-Kartoffelpflanzen.
Die Experimente wurden wie unter Abbildung 17 beschrieben
durchgeführt. Die Markierung erfolgte wie jeweils am rechten Rand
vermerkt mit den 32P-markierten fed 1-cDNA-Fragmenten aus Spinat bzw.
Kartof­fel. Ausgewählte transgene Linien sind wie angezeigt: Fd A62,
A93, A99, A100 („antisense“) und Fd S119, S125, S156 („sense“). WT:
Wildtyp
3.2.7 „Southern Blot“-Analyse des fed 1-Gens in Kartoffelblatt
Für das fed 1-Gen liegen in der Literatur für unterschiedliche
Pflanzenarten verschiedene Daten über die Kopienzahl im Genom vor. In
Pisum sativum (Dobres et al. 1987, Elliott et al. 1989) und A.
thaliana (Vorst et al. 1990) wurden ein bis zwei Kopien pro haploidem
Genom identifi­ziert, während die C4-Pflanze Triticum aestivum sechs
Kopien des fed 1-Gens enthält (Bringloe et al. 1995). Für
Kartoffelpflanzen sind bislang keine ent­spre­chenden Daten verfügbar.
Für die „Southern“-Hybridisierung wurde aus Kartoffelblättern
ge­nomische DNA isoliert und mit den in Abbildung 21 angegebenen
Restriktionsendonuklea­sen geschnitten. Die Hybridisierung des
„Southern Blots” erfolgte zunächst mit dem 32P-markier­ten fed 1-cDNA-Fragment
aus Kartoffel (s. Kap. 2.21). Markierung von jeweils nur einem
Fragment wurde nach Verdau mit BamHI (12 kb), EcoRI (12 kb), HincII
(0,6 bk), HindIII (1,9 kb) und XhoI (10-11 kb) erhalten. Je zwei
Fragmente wurden nach Behandlung mit PstI (ca. 10 kb, größer 12 kb),
ScaI (11 kb, 1,9 kb) und XbaI (11 kb; 1,9 kb) markiert. So­mit kann
davon ausgegangen werden, daß im Kartoffelgenom, vergleichbar zu den
für Erbse erhaltenen Ergeb­nissen, ein bis zwei Kopien des fed 1-Gens
vorliegen. Die Hybridisierung mit einem ent­spre­chend markierten
Spinat-Fragment ergab keine diskrete Bande.


1 2 3 4 5 6 7 8 9
Abbildung 21: „Southern Blot“-Analyse von fed 1 mit genomischer DNA
aus Kartoffel.
Genomische DNA aus Wildtyp-Kartoffelpflanzen (20 µg/Spur ) wurde mit
Restriktionsendonukleasen (Spur 1: BamHI, Spur 2: EcoRI, Spur 3:
HincII, Spur 4: HindIII, Spur 5: PstI, Spur 6: ScaI, Spur 7: SstI,
Spur 8: XbaI, Spur 9: XhoI) geschnitten und in einem 0,8%igen
Agarosegel elektrophoretisch aufgetrennt. Nach Denaturie­rung,
Neutralisierung und Kapillartransfer auf eine Nylonmembran erfolgte
die Hybridisierung mit dem 32P-markierten fed 1-cDNA-Fragment aus
Kartoffel. Als Standard wurde PstI verdaute -DNA verwen­det.
3.2.8 Licht-induzierte Akkumulation von fed 1-Transkripten in
Kartoffelblättern
Eine lichtabhängige Expression von für Fd I kodierende mRNA konnte
schon für die C4-Pflan­zen Zea mays (Hase et al. 1991) und Triticum
aestivum (Bringloe et al. 1995) gezeigt wer­den. Um den Effekt von
Licht auf die Änderung von fed 1-mRNA-Gehalten in Kartoffel zu
untersuchen, wurde ein für die Analysen zur licht-abhängigen
Expression des Gens der chloro­plastidären G6PDH angefertigter
„Northern Blot“ (freundlicherweise von Dr. A. von Schaewen,
Universität Münster, zur Verfügung gestellt) verwendet. Dazu wurden im
Dunkeln angezogene, etiolierte Kartoffelkeimlinge belichtet und
Gesamt-RNA zu den in Abbildung 22 angegebenen Zeitpunkten nach
Belichtungsbeginn isoliert. Nach Hybridisierung mit der fed 1-Sonde
aus Kartoffel konnte in allen Proben eine für das fed 1-Transkript
spezifische Bande von etwa 800 bp detektiert werden. Innerhalb der
ersten vier Stunden nach Belichtungsbeginn ist ein deutlicher Anstieg
im „steady-state“-Gehalt der fed 1-Transkripte zu verzeichnen. Nach
einer Belichtungszeit von 24 Stunden wiesen die Keimlinge eine mit
grünen Blättern ver­gleichbar starke Expression auf. Auffällig ist,
daß kein kontinuierlicher Anstieg in der Expres­sionshöhe des fed 1-Gens
erfolgt. So wurde nach sechsstündiger Belichtungsdauer eine größere
Menge an fed 1-mRNA detektiert als nach zwölf Stun­den und in für zwei
Stunden belichteten Keimlingen war eine geringere Expression als nach
einer Stunde zu verzeichnen. Parallelpro­ben von im Dunkeln belassenen
Keimlingen wiesen bis zu zwölf Stunden keine Änderungen in der fed 1-Expressionshöhe
auf. Nach vier Stunden Belichtung tritt in Weizenkeimlingen eben­falls
eine verstärkte Transskriptakkumulation auf, wobei die fed 1-RNA-Menge
auch nach 24 Stunden geringer als das nach vier Stunden detektierte
Signal war (Bringloe et al. 1995). Um Hinweise zu erhalten, ob die
detektierten Schwankungen in der fed 1-mRNA-Menge auf eine erhöhte
Transkriptionsrate bzw. eine verminderte Degradation zurückzu­führen
sind, erfolgte der Vergleich mit den für die chlorplastidäre G6PDH
erhaltenen Ergebnis­sen. Im Fall der G6PDH ist bis zu einer
Belichtungsdauer von sechs Stunden ein stetiger Anstieg in der
Transkripthöhe zu verzeichnen, die bis zu dem 24 Stunden-Wert stabil
blieb (von Schaewen et al. 1995). Zu diesem Zeitpunkt wurde ein g6pdh-Expressionsniveau
erreicht, das erst etwa 50% der maximal detektierbaren mRNA-Menge in
grünen Blättern entspricht. Vergli­chen mit dem Anstieg der
Transkription des fed 1-Gens scheint die Expression des plastidären
g6pdh-Gens sehr viel langsamer zu sein.


Licht (h) Dunkel (h)
0 0.25 0.5 1 2 4 6 12 D 24 grün 0.25 0.5 4 6
Abbildung 22: Lichtabhängige Expression des fed 1-Gens in
Kartoffelkeimlingen.
Von grünen Blättern und Sproßspitzen von ca. 14-Tage alten, dunkel
angezogenen Kartoffelkeimlingen wurde nach der jeweils angegebenen
Belichtungsdauer Gesamt-RNA isoliert. Die Hybridisierung des „Northern
Blots“ erfolgte mit 32P-markierten fed 1 cDNA-Fragmenten aus
Kartoffel. D = Dunkel
3.2.9 Bestimmung des Molekulargewichtes von Fd I aus Kartoffel
Für die qualitative Abschätzung der Fd I-Proteinmengen in Rohextrakten
von Wildtyp- bzw. transgenen Kartoffelpflanzen wurde ein polyklonaler
Antikörper für die Immundetektion ver­wen­det, der gegen das
gereinigte Fd I aus Spinat hergestellt worden war. „Western Blots“,
angefertigt mit equivalenten Mengen an Rohextrakt aus Spinat oder
Kartoffel (50 µg-200 µg lösliches Protein je Spur), zeigten nach
SDS-PAGE im „Immunprint“ vergleichbare Signale (Daten nicht ge­zeigt).
Fd konnte nach der denaturierenden Elektrophorese in keinem Fall als
scharfe Bande detektiert werden. Das Protein lag als breitere, leicht
diffuse Bande vor. Ein derartiges Laufverhalten wurde auch für das
gereinigte Fd I aus Tomate (Green et al. 1991) und für das Protein des
in vitro translatierten und nach Import in isolierte Chloroplasten
pro­zessierten fed 1-Klons aus Spinat (Wedel et al. 1988) beschrieben.
Eine anormale Interaktion des Enzyms mit SDS führt wahrscheinlich zu
weniger scharfen Banden in denaturierenden Gelen. Das apparente
Molekulargewicht war für das Protein aus beiden Pflanzenarten
identisch 18 kDa (vgl. Abb. 17).
In Rohextrakten von Kartoffelpflanzen wurde zusätzlich zu dieser
Hauptproteinbande oft ein 22 kDa-Protein sichtbar. Die in
denaturierenden Gelen generell auftretende Abweichung des appa­renten
Molekulargewichts von den über Sequenzdaten erhaltenen, berechneten
Größen ist auf die Gesamtladung des Proteins zurückzuführen (Zanetti & Merati
1987, Wedel et al. 1988, Green et al. 1991). Der azide Charakter von
Fd I bedingt vermutlich die Bindung einer niedrigeren Menge von
SDS-Molekülen (Huismann et al. 1978), so daß keine von der Ladung
weitgehend unabhängige Trennung erfolgt und das Enzym somit größer
er­scheint. Für den in dieser Arbeit isolierten cDNA-Klon aus
Kartoffel beträgt das von der Se­quenz abgeleitete Molekulargewicht
des Präproteins 15,8 kDa und das des maturen Proteins 10,8 kDa (bei
durchschnittlich 110 Da pro Aminosäure).
Die in der Literatur beschriebenen Werte ergeben bezüglich des
apparenten Molekulargewich­tes kein einheitliches Bild. Das aus
Spinatblättern gereinigte Enzym zeigt nach SDS-PAGE ein
Mole­kulargewicht von 22 kDa (Droux et al. 1987b), während Wedel et al. (1989)
ein Mole­kularge­wicht von 18 kDa angeben. Dies deckt sich in etwa mit
den Befunden für das gereinigte Fd I aus Nicotiana tabacum (17 kDa,
Huisman et al. 1978). Takahashi et al. (1986) erhielten nach
Inku­bation von isolierten Chloroplasten mit 35S-Cystein verschiedene
Fd-Formen, die über Elektrophorese voneinander zu unterscheiden waren.
Das Fd I-Holoenzym, d.h. ein Enzym, wel­ches das 2Fe2S-Zentrum
enthielt, wies in nativen Gelen ein Molekulargewicht von etwa 10 kDa
auf. Dagegen zeigte das Protein ohne die prosthetische Gruppe
(Apoprotein) ein deutlich langsa­meres elektrophoretisches
Wanderungsverhalten mit diversen Banden zwischen 20 kDa und 30 kDa.
Carboxymethylierung der Cysteinreste vor der Elektrophorese
resultierte in nur einer Bande, woraus die Autoren folgerten, daß ohne
diese Maßnahme eine zufällige Bildung von inter- und intramolekularen
Disulfidbrücken im Apoprotein stattfindet. Nach SDS-PAGE des 35S-markierten
Holo-Fd zeigte das Enzym ein apparentes Molekulargewicht von 22 kDa,
einhergehend mit einem fast vollständigen Verlust der inkorporierten
Radioakti­vität. Durch Be­handlung des Holoenzyms mit denaturierenden
Reagenzien, wie z.B. SDS oder Trichloressig­säure, wird vermutlich die
Freisetzung des im Eisen/Schwefel-Zentrum gebunde­nen, labilen
Schwefel-Atoms hervorgerufen, so daß Apo-Fd mit einer geringeren
elektropho­retischen Mobilität entsteht. Eine Änderung im
Laufverhalten in Abhängigkeit von Lagerungs­art und –zeitraum wurde
für das gereinigte Spinatprotein beschrieben (persönliche Mitteilung
von A. Tegeler, ehemals Universität Osnabrück). So konnte für das
direkt nach der Isolierung auf einem SDS-Gel aufgetrennte Fd I aus
Spinat ein Molekulargewicht von 22 kDa bestimmt werden. Nach
verschie­den langen Zeiten der Lagerung wurden aber auch
Molekulargewichte von 20 kDa, 17-19 kDa und kleiner beobachtet. Aus
diesem Grund wurden die Präparationen unmittelbar nach Abschluß der
Reinigung aliquotiert und in flüssigem N2 bis zur weiteren Verwendung
gelagert.
Um Aufschluß über das korrekte Molekulargewicht von Fd I aus Kartoffel
zu erhalten, erfolgte die partielle Reinigung des Enzyms aus Blättern
von Wildtyp-Kartoffelpflanzen in Anlehnung an die Methode von Walker
(1987). Nach SDS-PAGE und „Immunprint“ zeigten sowohl das
Kar­toffel-Enzym als auch das gereinigte Fd I aus Spinat ein
apparentes Molekulargewicht von 18 kDa (s. Abb. 23). Änderungen in der
Größe des Kartoffel-Fd I konnten weder nach Lage­rung in flüssi­gem N2
noch nach Aufbewahrung im Kühlschrank (4 °C) gefunden werden. Neben
diesem Signal wurde in der Kartoffel-Präparation ein Protein
vergleichbarer Stärke in Höhe von 38 kDa detek­tiert. Aufgrund der
extrem spezifischen Erkennung durch den Antikör­per und des
verdoppelten apparenten Molekulargewichts handelt es sich bei diesem
Protein vermutlich um ein artifizielles Fd-Dimer, das während der bzw.
durch die Reinigungsprozedur erzeugt wurde und auch nach Behandlung
mit SDS, Reduktionsmittel (Merkaptoethanol und DTTred) und Erhitzen
nicht trennbar war.

Kartoffel Spinat MW
(kDa)


Abbildung 23: Vergleichende „Western Blot“-Analyse zwischen dem
partiell gereinigten Fd I aus Kartoffelblatt und dem bis zur
Homogenität gereinigten Fd I aus Spinatblatt.
Je 0,5-1 µg der nachfolgend angegebenen Proteine wurden in einem
20%igen diskontinuierlichen SDS-Gel auf­getrennt und elektrophoretisch
auf eine Nitrozellulosemembran überführt. Spur 1: Kartoffel-Fd I nach
Lagerung in flüssigem N2 und einem zusätzlich durchgeführten
Zentrifugationsschritt (15800 g, 4 °C); Spur 2: Spinat-Fd I nach
Lagerung in flüssigem N2; MW: Molekularer Massenstandard in kDa
(vgl. Abb. 16)
Als weiterer Ansatz zur Molekulargewichtsbestimmung wurde unter
Verwendung eines ge­koppelten Transkriptions- und Translationssystems
eine in vitro-Translation des fed 1-cDNA-Klons, der auch die
Information für das Transitpeptid beinhaltet, durchgeführt. Das 35S-mar­kierte
Translati­onsprodukt ist in Abbildung 24 dargestellt und zeigte nach
SDS-PAGE und Autoradiographie ein apparentes Molekulargewicht von 22
kDa. Ein Kontrollansatz, dem keine cDNA zugefügt wurde, wies keine
Markierung auf (s. Abb. 24). Importversuche des 35S-mar­kierten,
translatierten Kartof­fel-Klons in isolierte, intakte Chloroplasten
verliefen ergebnislos, so daß über das Molekulargewicht des
pro­zessierten Proteins keine Aussagen gemacht werden können. Wedel et al. (1989)
gaben für das Translationsprodukt des Spinat cDNA-Klons ein apparentes
Molekulargewicht von 24 kDa an, d.h. ca. 6 kDa größer als das
importierte, prozes­sierte Protein. Vergleichbare Angaben liegen für
die translatier­ten Fd I-Vorstufen aus Nicotiana tabacum, Phaseolus
vulgaris und Chlamydomonas reinhardii vor (Huisman et al. 1978).


Abbildung 24: Autoradiogramm des in vitro-translatierten fed 1-cDNA-Klons
aus Kartoffel.
Die fed1-cDNA wurde unter Verwendung eines gekoppelten Systems (TNT
Coupled Reticulocyte Lysate Sys­tem; Promega, Madison, USA) in
Gegenwart von 35S-Methionin und zellfreiem Retikulozytenlysat aus
Kanin­chen nach Herstellerangaben transkribiert und translatiert. Die
Produkte wurden in einem 20%igen SDS-Gel aufgetrennt und das
getrocknete Gel bis zu einer Woche exponiert. Spur 1: Luziferase
(Positivkon­trolle), Spur 2: Translationsprodukt von fed 1 aus
Kartoffel; Spur 3: Molekulargewichtstandards, (vgl. Abb. 16); Spur 4:
Kon­trollansatz ohne fed-cDNA (Negativkontrolle).
3.2.10 Phänotypanalyse an primären und aus Knollen gezogenen
Fd I-Kartoffeltrans­formanten
Schon in Gewebekultur, vor einer differenzierten Charakterisierung,
zeigten viele der mit fed 1 in „antisense“-Orientierung
transformierten Regeneranten starke Unterschiede bezüglich der
Pig­mentierung und auch der Wuchshöhe bzw. der
Wachstumsgeschwindigkeit im Vergleich zu den sterilen
Wildtyp-Kartoffelpflanzen (Daten nicht gezeigt). So konnte bei einer
großen An­zahl der „antisense“-Pflanzen eine verringerte Grünfärbung
der Blätter sowie ein retardiertes Wachstum festgestellt werden.
Einige der Pflanzen waren trotz Wurzelausbildung nicht in der Lage auf
Agar zu überleben oder gingen dann nach Umsetzen in Erde ein. Im
zeitlichen Ver­lauf war ein immer stärkeres „Ausbleichen“ der Blätter
zu beobachten. Diese Merkmale konn­ten aber ebenso Pflan­zen
zugeordnet werden, die nach „Western blotting“ einen den
Wildtyp-Pflanzen vergleichbaren endogenen Gehalt an Fd I aufwiesen.
Bei einigen Pflanzen ist diese
frühe Phänotypausbildung offenbar auch einer Spätfolge der
Regeneration in Gewebekultur, d.h. den von Masle et al. (1993)
untersuchten „tissue-culture after effects“, zuzuordnen. Nach Umsetzen
der primären Transformanten in Erde und Anzucht unter
Gewächshausbedingungen traten diese Effekte weiter­hin auf. Stark
supprimierte Linien, wie z.B. A99 oder A6 zeigten eine blaßgrüne,
gelbliche Blatt­farbe, die oft an den Blattadern stärker ausgeprägt
war, so daß ein fast mosaikartiges Färbungs­muster entstand. Nach ca.
dreiwöchiger Kultivierung wiesen auch die „sense“-Transformanten eine
deutliche, zunächst visuell festgestellte Abweichung im
Erscheinungsbild gegenüber den Wildtyp-Kartoffelpflanzen auf. Der
Phänotyp der „sense“-Pflanzen zeichnete sich durch eine dunklere
Grünfärbung der Blätter und eine erhöhte Wachs­tumsrate aus.
Um die Signifikanz dieser Abweichungen mit einem veränderten endogenen
Fd I-Gehalt kor­relie­ren und „tissue-culture after-effects“
ausschließen zu können, wurden ausgewählte trans­gene Li­nien aus
Knollen unter konstanten Wachstumsbedingungen, insbesondere unter
kon­stanten Licht­bedingungen, in einer Klimakammer angezogen und
nochmals auf den erhöhten bzw. gedrossel­ten Gehalt an Fd I (sowohl
auf RNA- als auch Proteinebene) überprüft. Eine differenziertere
Analyse erfolgte auf der Basis folgender Parameter:
 Phänotyp-Analyse nach sechs Wochen Anzucht in einer Klimakammer
 Bestimmung der Chlorophyll a- und b-Gehalte (Chl a und Chl b), sowie
der Gesamt-Chloro­phyllgehalte
 Messung von Gesamt-Proteingehalten
 Änderungen im A830-Signal (Fernrotsignal)
 Bestimmung der Chlorophyllfluoreszenz belichteter Transformanten
nach Dunkeladapta­tion
 Bestimmung der FO/FM-Verhältnisse
Interessanterweise fielen die oben beschriebenen, deutlich
ausgeprägten Unterschiede im Phäno­typ nach der Anzucht aus Knollen
bei einer konstanten Lichtintensität von ca. 350 µE und einer
zehnstündigen Belichtungsdauer nicht mehr so dramatisch aus. In den
„antisense“-Pflanzen mit einer den Wildtyp-Pflanzen vergleichbaren
Expression oder bis zu 20%igen Re­duktion im Fd I-Gehalt wurden keine
Unterschiede im Phänotyp zu den Wildtyp-Pflanzen festgestellt (z.B.
A93, A62, A100  Gruppe 1). Die Transformanten mit Fd I-Gehalten
zwi­schen 50% und 80% der Kontrollpflanzen (z. B. A99 und A150 
Gruppe 2) fielen durch einen stetig abnehmende Grün­färbung der
Blätter auf, die nach einer Anzuchtdauer von sechs Wochen als blaßgrün
zu bezeich­nen war und in manchen Fällen schon ins Gelbliche überging
(s. Abb. 25A und 25B). Demgegen­über wiesen die Blätter der
„sense“-Pflanzen ein dunkleres Grün als die der Wildtyp-Pflanzen auf
(s. Abb. 25A und 25B). Bei diesem Pigmentverlust han­delt es sich wohl
um einen dynamischen Prozeß, der über eine längere Wachstumsperiode
immer stärker ausgeprägt wird, da die jüngsten Blätter einer
„antisense“-Pflanze wesentlich dunkler grün gefärbt sind als die
älteren Blätter (s. Abb. 25C).

A

B

C

A99

WT

Blattnummer
Abbildung 25: Phänotyp von Kartoffelpflanzen mit erhöhten oder
erniedrigten Gehalten an Fd I.
A: Ausgewählte Pflanzen der transgenen Linien Fd A99 (links), Fd S156
(rechts) und Kontrollpflanzen (Mitte) nach sechs Wochen Anzucht in
einer Klimakammer. B: Photographien der vierten Blattfiedern von den
in A dargestellten Pflanzen. C: Blätter von zehn Wochen alten Fd
I-A99-Pflanzen und Wildtyp-Pflanzen. Blatt Nr. 1 stellt das jüngste
Blatt dieser Pflanzen dar. In Abb. 5C ist der kontinuierliche
Chlorophyllverlust einer stark gedros­selten „antisense”-Linie
dargestellt.
Diese visuellen Unterschiede konnten durch Bestimmung der
Chlorophyllgehalte nach sechs­wöchiger Anzucht in Klimakammern
verifiziert werden. Die Blätter der Wildtyp-Pflanzen ent­hielten
41 µg ± 15 Gesamtchlorophyll × cm-2, wobei die „antisense“-Linien nur
zwischen 60% und 95% dieses Wertes erreichten. Die
„sense”-Transformanten zeigten mit 110-120% des in
Wildtyp-Kartoffelpflanzen bestimmten Gehaltes eine Erhöhung des
Gesamt-Chlorophyllge­haltes (s. Abb. 26A). Somit wurde eine
Abhängig­keit der Chlorophyllmenge von dem jeweili­gen fed 1-Expressionsgrad
festgestellt, die besonders bei den „antisense“-Pflanzen sehr
deut­lich ausgeprägt war.

Abbildung 26: Vergleich der Gesamtchlorophyll-Gehalte (A), Chlorophyll
a/b-Verhältnisse (B), Proteingehalt (C) und NADP-MDH-Kapazität (D)
zwischen Wildtyp- und transgenen Kartoffelpflanzen mit variierten
Gehalten an Fd I.
Die Anzucht der gekennzeichneten transgenen Linien und
Wildtyp-Kartoffelpflanzen erfolgte unter kontrol­lier­ten Bedingungen
für sechs Wochen in einer Klimakammer. Die Lichtintensität betrug
350 µE in Pflan­zenhöhe. Für alle Messungen wurden Proben aus der
vierten Endfieder entnommen. Die für die Wildtyp-Pflanzen erhalte­nen
Werte wurden auf 100% gesetzt. Sämtliche Werte stellen Mittelwerte (±
SD) aus min­destens drei unabhän­gigen Experimenten dar.
Um genaueren Aufschluß über etwaige unterschiedliche bzw. auch
gegenläufige Änderungen im Chl a- oder/und Chl b-Gehalt zu bekommen,
erfolgte zusätzlich eine getrennte Bestimmung dieser Werte. Dabei
wurde deutlich, daß sowohl der Chl a- als auch der Chl b-Gehalt
betroffen war, wo­bei stärkere Änderungen in der Chl b-Menge
auftraten. Die Blätter der Wildtyp-Pflan­zen enthiel­ten 0,31 mg Chl a
· m-2 und 0,092 g Chl b · m-2. In den „antisense“-Pflanzen war der Chl
a-Gehalt auf 81-95% verringert, während der Chl a-Gehalt in den
„sense”-Linien um 10% höher als in den Blättern der Wildtyp-Pflanzen
lag. Der Chl b-Gehalt der „antisense”-Linie A150 war um 30%
verringert, während in Pflanzen der „sense“-Linie S138 20% mehr Chl b
im Vergleich zu den Wildtyp-Pflanzen bestimmt wurde. Dadurch war das
Verhältnis von Chl a zu Chl b mit Werten bis zu 4,1 in den
„antisense“-Pflanzen (A99) im Vergleich zu 3,5 in den Kontrollpflanzen
stark erhöht, während in den „sense”-Linien bis zu 20% geringere
Verhält­nisse bestimmt wurden (s. Abb. 26B). Diese Ergebnisse wurden
an der dritten und vierten voll­ständig entwickelten Endfie­der der
jeweiligen Pflanzen erzielt, wobei die Verwendung der größten
Seitenfiedern dieser Blät­ter zu gleichen Ergebnissen führte.
Im Proteingehalt der verschiedenen Pflanzen waren nur geringe
Unterschiede feststellbar. Die Wildtyp-Pflanzen wiesen einen
durchschnittlichen Proteingehalt von 5,6 mg  m-2 auf, während bei den
„antisense“-Pflanzen ein tendenziell geringfügig erhöhter und in den
„sense“-Pflanzen ein leicht verringerter Proteingehalt festgestellt
wurde (s. Abb. 26C).

Abbildung 27: Darstellung typischer Schreiberkurven zu
Chlorophyllfluoreszenz und P700-Messungen von Fd I-„sense“- und
-„antisense“-Kartoffelpflanzen im Vergleich zu Wildtyp-Pflanzen.
Die Messung der Parameter erfolgte parallel mit zwei PAM-Fluorimetern
(vgl. Kap. 2.5). Die eingestrahlte Lichtintensität betrug 850 µE. S46:
Fd I-Überexprimierer; A150: Fd I-Unterexprimierer; WT:
Wildtyp-Kar­toffelpflanze
Weiterhin wurden in Pflanzen mit erhöhten oder erniedrigten
Fd I-Gehalten einige Verände­rungen in der A830- und der
Chlorophyllfluoreszenz sichtbar. Für eine bessere Übersicht sind
Schreiber­kurven von typischen Experimentverläufen in Abbildung 27
dargestellt. Die Belich­tung von dunkeladaptierten Blättern mit
sättigendem Fernrotlicht ( 716 nm) regt separat PS I an, das dadurch
von dem im Dunkeln vorliegenden, vollständig reduzierten Zustand in
den vollständig oxidierten Zustand überführt wird. Dieser Übergang
verursacht dann meßbare Än­derungen im A830-Signal. Als
Berechnungsbasis dienten in den hier durchgeführten Experi­menten die
von Wildtyp-Pflanzen erhaltenen Fernrot-Amplituden, welche als
relative Fernrot-Werte auf 100% gesetzt wurden (vgl. Abb. 4). In allen
untersuchten „antisense“-Linien war eine Abnahme im Fernrot-Signal
meßbar (s. Abb. 27F und Abb. 28A). Die Linien A100, A93 und A62 der
Gruppe 1 zeigten relativ einheitlich eine durchschnittlich um 30%
verringerte Fernrot-Amplitude. Dies Signal lag bei den Linien A150 mit
einer 60%igen und A99 mit einer 75%igen Reduktion noch signifikant
unter diesen Werten. Die Bestimmung der Fernrot-Signale von
überexprimierenden Pflanzen hingegen ergab eine jeweils rela­tive
Erhöhung der Amplitude zwischen 10% (S119) und 40% (S138) im Vergleich
zu den Wildtyp-Pflanzen (s. Abb. 28A, vgl. auch 27D).

Abbildung 28: Fernrot-Signal (A) und FO/FM-Verhältnisse (B) in
Blättern von Wildtyp-Kartoffelpflan­zen und Transformanten mit
erhöhtem bzw. erniedrigtem Gehalt an Fd I.
Die Bestimmung der Parameter erfolgte parallel mit zwei
PAM-Fluorimetern bei einer Lichtintensität von 850 µE. Alle
aufgeführten Daten sind Mittelwerte aus unabhängigen Experimenten (n 
3,  SD), wobei die vom Wildtyp erhaltenen Daten als 100% gesetzt
wurden.
Unterschiede traten ebenfalls in den FO/FM-Verhältnissen von
Dunkel-adaptierten Blättern mit verändertem Fd I-Gehalt im Vergleich
zu solchen von Wildtyp-Pflanzen auf (s. Abb. 27A-C und Abb. 28B).
Innerhalb der „antisense“-Linien war eine Divergenz bezüglich dieses
Para­meters feststellbar: Sehr stark reduzierte Verhältnisse (zwischen
50% und 70% des Wildtyp-Verhältnisses) zeigten die „antisense“-Linien
der Gruppe 2 (hier A99 und A150) während eine Erhöhung um
durchschnittlich 30% bei den Linien A62, A93 und A100 der Gruppe 1
gemes­sen wurde. Die Abnahme im FO/FM-Verhältnis ist ein Indikator für
Photoinhibition. Solch große Un­terschiede waren innerhalb der
„sense“-Linien und auch im Vergleich zu den Wildtyp-Pflanzen nicht zu
beobachten, d.h. nur eine minimale Erhöhung des FO/FM-Verhält­nisses
trat auf.
Eine weitere typische Differenz zwischen den Wildtyp-Kartoffelpflanzen
und den transgenen Kartoffelpflanzen konnte auf Ebene der sogenannten
Dunkel-Fluoreszenz-Relaxation beo­bachtet werden. Zur Be­stimmung
dieses Parameters erfolgte die Belichtung von Kartoffel­pflanzen mit
steigenden Licht­intensitäten über einen Zeitraum von einer Stunde.
Anschließend wurde das Licht ausgeschaltet und die nachfolgenden
Änderungen in der Fluoreszenz für fünf Minuten mittels eines
PAM-Fluorimeters aufgezeichnet. Einige typische Beispiele der
erhalte­nen Schreiberkurven sind in Abbildung 29A dargestellt. Nach
Verdunkelung der Blätter fiel die Chlorophyllfluoreszenz-Emission
sofort auf FO-Niveau ab. Nach kurzer Zeit war ein er­neuter,
transienter Anstieg zu verzeichnen, der sich bei allen untersuchten
Pflanzen, mit Aus­nahme der „antisense“-Linie A99, oberhalb der FO-Linie
stabilisierte. Bei Pflanzen mit verän­derten Gehalten an Fd I konnten
Unterschiede so­wohl in der initialen Rate der Fluores­zenz-Zunahme
als auch in der Fläche, die durch den tran­sienten Anstieg der
Dunkel-Fluores­zenz eingeschlossen wurde (in Abb. 29A durch die
unterbro­chene Linie gekennzeichnet), ausge­macht werden. Diese
Flächen wurden jeweils für die einzelnen Pflanzen bestimmt und sind in
Abbildung 29B zusammengefaßt. Die durchschnittlichen Flächen der
Wildtyp-Pflanzen sind als 100% dargestellt. Verglichen mit den
Wildtyp-Pflanzen wiesen die „sense“-Linien eine leicht erhöhte
initiale Rate in der Zunahme der Dunkel-Fluoreszenz-Relaxa­tion auf
und die unter dieser Kurve liegenden Flächen waren in den meisten
„sense“-Linien ge­genüber den Wildtyp-Pflanzen vergrößert. Besonders
die Linie S138 zeigte eine etwa 2,5fache Erhöhung dieses Wertes. Im
Gegensatz dazu war die unter den Kurven der „antisense“-Pflanzen
liegende Fläche extrem reduziert bzw. wie im Fall der Linie A99 kaum
mehr meßbar.

A

S138
A150
WT #10

FO-Niveau



A99
WT #9
S125

FO-Niveau


1 min


Abbildung 29: Änderung von Dunkel-Fluoreszenz Relaxation am Ende der
Belichtungsphase von Fd I-„sense“-, Fd I-„antisense“- und
Wildtyp-Kartoffelpflanzen.
Blätter der designierten Pflanzen wurden mit steigender
Lichtintensität belichtet. Die Messungen wurden mit der niedrigsten
Lichtintensität begonnen und nach Erreichen der „steady state“
Photosynthese (15-20 min) erfolgte die Belichtung mit der nächst
höheren Stufe. Anschließend wurde das Licht an dem durch einen
vertikalen Pfeil gekennzeichneten Zeitpunkt ausgeschaltet und die
Chlorophyllfluoreszenz mit Hilfe eines PAM-Fluorimeters fünf Minuten
lang aufgezeichnet. Jedes Experiment wurde mindestens dreimal
wieder­holt. Sämtliche Analysen wurden an Blättern der vierten
Endfieder der Pflanzen durchgeführt. A: Typische Schreiberkurven von
Fd I-Transformanten und Wildtyp-Kartoffelpflanzen (WT). Als
Vergleichsgrundlage diente die unter den Kurven entstandene Fläche
(durch die unterbrochene Linie gekennzeichnet). B: Zusam­menfassung
der für die einzelnen Pflanzen bestimmten Flächen. n.d. = nicht
detektiert.
3.2.11 Photosynthetische Eigenschaften der Fd I-Über- und
-Unterexprimierer
Fd I fungiert im Chloroplasten höherer Pflanzen zum einen als
Elektronenakzeptor am PS I und zum anderen nachfolgend als zentraler
Elektronendonor für assimilatorische aber auch re­gulatorische
Reaktionen (Details s. Kap. 1.2). In diesem Kapitel soll zunächst der
Einfluß ver­än­derter Fd I-Gehalte von transgenen im Vergleich zu
Wildtyp-Kartoffelpflanzen auf Para­meter bzw. Reaktionen während der
„steady state“-Photosynthese dargestellt werden. Die aus­gewählten
Parameter sind direkt aber auch indirekt an den licht­getriebenen
Elektronentransport und dessen nachgeschaltete Reaktionen im
Chloroplastenstroma gekoppelt. Daher wurden fol­gende Untersuchungen
bei kontinuierlicher Belichtung mit di­versen Lichtintensitäten
durchge­führt:
 „steady state“-Assimilation
 Chlorophyllfluoreszenz (Berechnung von qP, qNP, I, II)
 P700-Messungen
Die Lichtsättigung der CO2-Assimilation lag sowohl für die
Wildtyp-Pflanzen als auch für sämt­liche transgene Linien bei einer
Lichtintensität von 900 µE, so daß die doch stark verän­derten
endogenen Mengen an Fd I offensichtlich keinen Einfluß auf diesen
Parameter nehmen (s. Abb. 30A).
In der CO2-Fixierungsrate wurden mehr oder weniger große Unterschiede
zwischen den „sense“- und „antisense“-Transformanten im Vergleich zu
den Wildtyp-Pflanzen deutlich (s. Abb. 30A). Die Assimilationsraten
der überexprimierenden Linien lagen um 10-15% über den für die
Wildtyp-Pflanzen bestimmten Werten (S138: 16 µmol  m-2  s-1;
Wildtyp: 14 µmol  m-2  s-1). Diese Unterschiede traten besonders bei
höheren Lichtintensitäten auf. Im Gegensatz dazu zeigten sämtliche
Unterexprimierer eine Fixierungsrate, die schon ab Licht­stärken um
150 µE stark ver­ringert war. Vergleichbar z.B. mit den Befunden für
die FO/FM-Verhältnisse war wiederum eine starke Inhomogenität zwischen
den beiden „antisense“-Gruppen zu beobachten: Die Linien A62, A93,
A100 wiesen eine durchschnittliche Assimila­tionsrate von 10 µmol  m-2
 s-1 auf, während die Raten der Linien A99 und A150 mit 6 µmol  m-2  s-1
nochmals 40% niedriger waren. Dies entspricht einer ca. 70%igen
Reduktion der Assimilationsrate im Vergleich zu den Wildtyp-Pflanzen.
Weitere Unterschiede wurden nach Messung der Chlorophyllfluoreszenz
deutlich, die als Grund­lage für die Berechnung verschiedener
Parameter, wie den am PS II anliegenden Elek­tronendruck (qP), die
Quantenausbeute von PS II (II) bzw. PS I (I) und den über die
Thyla­koidmembran auf­gebauten Protonengradienten (qNP) dient (Details
s. Kap. 2.5).
Die „antisense“-Linien der Gruppe 1 (A62, A93, A100) zeigten im
Vergleich zu den Wildtyp-Pflanzen bei allen Lichtintensitäten einen um
etwa 30% geringeren qP-Wert (A93 exemplarisch in Abb. 30B
darge­stellt), der für die Linien der Gruppe 2 (A99 und A150) nochmals
um 20% verringert vorlag (A99 exemplarisch in Abb. 30B). Im Gegensatz
dazu konnten für die „sense“-Pflanzen (dargestellt S138), die über
einen bis zu 2,5fach höheren Fd I-Gehalt verfügen, nur eine leichte
Erhöhung dieser Werte be­stimmt werden. Parallel dazu traten
Änderungen in der Lichtnutzungs-Effizienz auf, die über die Berechnung
der Quantenausbeute des PS II (II) beschrieben werden kann: Eine
geringere Licht­nutzung wurde für die „antisense“-Pflanzen bestimmt,
während die „sense“-Pflanzen eine Erhöhung zeigten (s. Abb. 30C).
Die größten Differenzen sowohl im anliegenden Elektronendruck als auch
in den Quantenaus­beuten traten bei geringeren Lichtintensitäten auf,
eine Annäherung war bei extremeren Licht­stär­ken (1600 µE) zu
verzeichnen. Die I-Werte nahmen vergleichbar mit den für II
berech­neten Werten mit steigender Lichtintensität ab (s. Abb. 30D und
30E). Die für die „antisense“-Linien berechneten Werte lagen besonders
bei Lichtintensitäten zwischen 150 µE und 900 µE deutlich unter denen
der Wildtyp-Pflanzen und für die „sense“-Linien wurde eine Erhöhung
gefunden. Bei Lichtintensitäten um 1600 µE zeigten alle Pflanzen
identische Ausbeuten. Ver­glichen mit den zugehörigen II-Werten waren
in den Unterexprimierern, besonders im Fall von A99, die
Quanten­ausbeuten von PS I signifikant höher. Dies deutet auf einen
höheren Elektronenfluß durch das PS I im Vergleich zum PS II hin.

A
D
0
0
B
E
C
F
Abbildung 30: Messung von CO2-Assimilation (A),
Elektronendruck am PS II (qP, B), Protonengradient (qNP, C),
Quantenausbeuten am PS I (I, D) und PS II (II, E), und P700
Redoxzustand (F) an Wildtyp- und transgenen Kartoffelpflanzen in
Abhängigkeit von der Lichtintensität.
In der Abbildung sind typische Ergebnisse von Wildtyp-Pflanzen (),
von Fd I-Unterexprimierern der Li­nien A99 () und A93 () und der
Fd I-überexprimierenden Linie S138 () dargestellt.
Die Bestimmung des Protonengradienten (qNP) ergab wiederum extreme
Unterschiede zwi­schen den zwei Gruppen der Unterexprimierer: An den
Linien A99 und A150 wurden mit den Wildtyp-Pflanzen vergleichbare
Werte bestimmt (s. Abb. 30C). Die Messung der Linien A100 als auch A62
und A93 ergab qNP-Werte, die 200% der in Wildtyp-Pflanzen bestimmten
Werte entsprechen. Dies deutet auf einen extrem erhöhten
Protonengradienten hin. In diesem Zu­sammenhang sei nochmals auf den
Unterschied in dem Grad der Photoinhibition zwischen den beiden
Gruppen der „antisense“-Pflanzen hingewiesen, der aus den FO/FM-Verhältnissen
ab­zuleiten ist (s. Abb. 28B). Die hohen qNP-Werte wurden für die
Linien A62, A93, A100 mit ebenfalls erhöhten FO/FM-Verhältnissen
berechnet, während parallel zu den niedrigeren Ver­hältnissen der
Linien A99 und A100 eine starke Abnahme in den qP-Werten zu
verzeichnen war. Eine relaxiertere Situation am PS II wurde für die
„sense“-Linien gefunden (dargestellt S138; s. Abb. 30B und 30C):
Sowohl qP als auch II waren erhöht, während der trans­membrane
Protonengradient (qNP) vergleichbar mit dem der Wildtyp-Pflanzen ist.
Weitere Unterschiede wurden an der Akzeptor Seite von PS I deutlich
(s. Abb. 30F). Während der kontinuierlichen Belichtung mit aktinischem
Licht wurde zunächst ein sättigender Licht­puls auf die Blätter
appliziert, der P700 vollständig oxidiert, gefolgt von einem
Dunkelpuls von drei Se­kunden, durch den P700 wieder in den
reduzierten Zustand überführt wird. Die Unter­schiede zwischen P700ox
und P700red im Licht wurden dann mit den im Dunkeln erhaltenen
FR-Signalen (vgl. Kap. 2.5.2) verglichen. Die Unterschiede zwischen
den im Dunklen erhalten Signalen zu denen im Licht weisen dann auf den
Reduktionsgrad des PS I hin. Im Schwach­licht lagen die “steady
state“-A--Werte der Wildtyp-Pflanzen bei weniger als 10% und gingen
nach Belichtung mit höheren Lichtstärken gegen Null. In den
„sense“-Linien waren unter sämtlichen Bedingungen die A--Werte nahe
Null. Hohe A--Werte bis zu 40% konnten hin­gegen in den
„antisense“-Linien be­stimmt werden, wobei der Kurvenverlauf wiederum
die Unterschiede zwischen den Linien A99 (Gruppe 2) und A100 (Gruppe
1) verdeutlicht.
3.2.12 Elektronenverteilung während der Induktion der Photosynthese in
Fd I- „sense“- und -„antisense“-Pflanzen
Unmittelbar nach Einsetzen der Belichtung erfolgt die Bereitstellung
von Elektronen. Dieser im Bereich von Sekunden ablaufende Prozess ist
verglichen mit dem Einsetzen der CO2-Assimilation und der Aktivierung
von Enzymen, Vorgänge die Minuten benötigen, extrem schnell. Daher ist
besonders während der Induktionsphase, in der die verbrauchenden
Reak­tionen noch nicht akti­viert sind, eine große Menge an Elektronen
vorhanden. In dieser Situa­tion ist dann die Vorausset­zung für eine
Übertragung von Elektronen auf O2 gegeben, wie sie auch von Marsho et al. (1993)
für isolierte Chloroplasten während der Induktionsphase der
Photosynthese beschrieben wurde. Eine Möglichkeit zur Regulation des
Elektronenflusses ist ebenfalls durch den zyklischen
Elektronentransport gegeben, während das Malat-Ventil nur begrenzt
Überschußelektronen ent­sorgen kann, da die Aktivierung dieser Sequenz
ebenfalls ca. eine Minute benötigt (Backhausen et al. 1994).
In diesem Kapitel sind Experimente zusammengefaßt, die den Effekt von
erhöhten bzw. ernied­rigten endogenen Fd I-Gehalten auf den
Redoxzustand verschiedener dem Elektronen­transport zugehöriger
Reaktionen in dieser Phase analysieren. Dazu wurden die unter Kapi­tel
3.2.10 vorge­stellten Messungen nicht im „steady state“ sondern in
Abhängigkeit von der Zeit an für eine Stunde vorverdunkelten Pflanzen
unter ambientem CO2 mit einer Lichtinten­sität von 850 µE
durchgeführt. Weiterhin erfolgte die Bestimmung der
Aktivierungszustände der NADP-MDH und die massenspektroskopische
Bestimmung der O2-Aufnahme.
In den Wildtyp-Pflanzen und den Fd I-„sense“-Pflanzen setzte die CO2-Assimilation
nach einer „lag“-Phase von ein bis zwei Minuten ein und stieg im
weiteren zeitlichen Verlauf stetig an. Schon nach achtminütiger
Belichtungszeit wiesen die „sense“-Pflanzen die bereits be­schriebene
um 15% höhere Assimilationsrate auf (s. Abb. 31A). Demgegenüber setzte
die Assi­milation bei den Fd I-Unterexprimierern verzögert ein, d.h.
die „lag“-Phase dauerte länger, und resultierte in der beobachteten
verminderten Assimilationsrate (s. Abb. 31A, vgl. Abb. 30A).
Innerhalb der ersten Minuten nach Einsetzen der Belichtung war in
sämtlichen Pflanzen der am PS II anliegende Elektronendruck sehr hoch
(s. Abb. 31B), der dann parallel mit Einsetzen der CO2-Assimilation
abnahm (s. Abb. 31A). Schon innerhalb der ersten Minute lagen die für
die „antisense“-Linien A99 und A100 bestimmten qP-Werte unter den in
den Wildtyp-Pflanzen ge­messenen Werten. Diese Erhöhung im
Elektronendruck am PS II trat über den gesamten Meßzeitraum in
Erscheinung und ging mit einer verminderten CO2-Assimilationsrate
einher. Deutliche Unter­schiede waren wieder zwischen den beiden
Gruppen der „antisense“-Linien zu verzeichnen. Im Vergleich dazu
wurden für die „sense“-Linien, insbesondere nach Stabilisie­rung der
CO2-Assi­milationsraten nach sechs bis sieben Minuten, höhere
qP-Werte, d.h. ein nicht so hoher Re­dukti­onsgrad der
Elektronentransportkette, und eine gleichzeitig erhöhte CO2-Assimilation
be­stimmt (s. Abb. 31A, B).
Durch die im Weiteren durchgeführte Bestimmung der
Aktivierungszustände der im Chloro­plasten lokalisierten NADP-MDH
können Aussagen über den unter den gewählten Bedin­gun­gen
vorherrschenden Redoxzustand des NADPH/NADP-Verhältnisses getroffen
werden. Durch den Regulationsmechanismus, dem dieses Enzym unterliegt,
reflektiert der Anteil an akti­viertem Enzym das stromale
Redoxverhältnis der Pyridinnukleotide (Scheibe 1989). Nach
Ein­stellung des „steady state“ liegen die Aktivierungszustände
zwischen 20% und 30% der maximal meßbaren Enzymaktivität, bestimmt
nach in vitro-Aktivierung mittels DTTred (s. Abb. 31C). Dies
entspricht den ebenfalls von Backhausen et al. (1998) ermittelten
Werten. Eine Akkumulation von NADPH, verursacht durch z.B. steigenden
Elektronendruck oder Ak­zeptorlimitierung, führt dann zu einer
Erhöhung des Aktivierungszustandes der NADP-MDH (Backhausen et al. 1998).
Ein derartiger transienter Aktivitätsanstieg auf 40% war bei den
Wildtyp-Pflanzen in den ersten bei­den Belichtungsminuten zu
beobachten, während im weite­ren Verlauf eine Stabilisierung bei
niedrigeren Werten um 30% der Kapazität erfolgte. Etwas geringere
Aktivierungszustände, ins­besondere nach Stabilisierung der CO2-Assimilationsrate
nach sechs bis acht Minuten, wurden in den „sense“-Linien gefunden. In
den moderateren „anti­sense“-Linien war eine zeitliche Verzöge­rung im
transienten Aktivitätsanstieg zu beo­bachten, der aber ein den
Wildtyp-Pflanzen ver­gleichbares Niveau erreichte. Im Fall der Linie
A99 wurde eine vollständige Aktivierung des En­zyms (= 100% der
Kapazität) nach drei Minuten Belichtung ermittelt, die aber im
weiteren zeitli­chen Verlauf auf das Kontrollniveau abfiel und auch
unter „steady state“-Photosynthese kaum eine Erhöhung zeigte.

Abbildung 31: Elektronenverteilung in Fd I-über- und
-unterexprimierenden sowie Wildtyp-Kartoffelpflanzen während der
photosynthetischen Induktionsphase.
Die Messungen erfolgten in Abhängigkeit von der Belichtungszeit an
Dunkel-adaptierten Blättern und stellen typische Resultate der
„sense“-Linie S138 (), der „antisense“-Linien A99 (); A93 () und
der Wildtyp-Pflan­zen () dar. Die applizierte Lichtintensität betrug
konstant 850 µE. Jedes Experiment wurde mindes­tens dreimal
wiederholt, wobei eine maximale Abweichung von 10% auftrat. Sämtliche
Analysen wurden an der vierten End­fieder durchgeführt. A: CO2-Assimilationsrate;
B: Bestimmung von qP; C: NADP-MDH-Aktivie­rungszustand; D: Beziehung
zwischen den Elektronenflüssen von PS I (I) und PS II (II); E:
Massen­spektro­skopische Unter­suchung der [18O]-O2-Aufnahme an
Blattscheiben von Wildtyp-Kartoffel­pflanzen, Fd I-„sense“- (S138) und
-„antisense“-Linien (A99).
Die in Blättern auftretenden Raten des zyklischen
Elektronentransportes können über den Ver­gleich der Elektronenflüsse
durch PS I und PS II ermittelt werden. Eine relative Zunahme des
Elektronenflusses durch PS I im Vergleich zu dem durch PS II deutet
dann auf einen erhöhten Elektronenfluß über den zyklischen Weg hin.
Die Auftragung der I- gegen die II-Werte (s. Abb. 31D) zeigt, daß
nur in den ersten Belichtungsminuten in den Wildtyp-Pflanzen und in
Pflanzen mit erhöhtem Fd I-Gehalt gerinfügige Abweichungen von dem
Verhältnis 1 auftraten. Unter diesen Bedingungen, wie z.B. ambiente CO2-
und O2-Konzentration im Meßgas und Belichtung der Blätter mit 850 µE,
fand trotz des am Anfang der Belichtung hohen Elektronendruckes kein
zyklischer Elektronen­transport in größerem Maße statt. Ein
vollständig anderes Bild ergeben die an den „antisense“-Linien
ermittelten Werte. Anhand dieser Ergeb­nisse können die Pflanzen mit
gedrosselten Fd I-Gehalten wieder in die schon oben angespro­chenen
zwei Gruppen unterteilt werden. So wurde in den Linien A62, A93 und
A100 (Gruppe 1) zu Beginn der Belichtung ein gegenüber den
Wildtyp-Pflanzen verdoppeltes Verhältnis von I zu II bestimmt, das
im weiteren Verlauf sukzessiv auf einen Wert von 1,5 sank. Die
Unte­rexprimierer der Linien A99 und A150 (Gruppe 2) zeigten einen
sehr ähnlichen Kur­venverlauf, nur lagen sämtliche Werte deutlich über
den in der anderen Fd I-Kategorie bestimm­ten.
Eine weitere Möglichkeit der Beseitigung von „Überschußelektronen“ ist
die nicht-enzymati­sche Übertragung auf O2 in der Mehler-Reaktion, die
mit einer gleichzeitigen Aufnahme von O2 ein­hergeht. Diese O2-Aufnahme
erfolgt ebenfalls beim Auftreten von Photorespiration und
mito­chondrialer Respiration. Ein O2-Verbrauch kann
massenspektroskopisch direkt quantifi­ziert und von der [16O]O2-Freisetzung
aus H2O unterschieden werden, wenn der Gasphase radioaktiv mar­kierter
Sauerstoff ([18O]) zugesetzt wird. Diese Experimente wurden bei der
etwas niedrigeren Lichtintensität von 600 µE im Vergleich zu 850 µE an
Blattscheiben der entsprechenden Pflanzen anstatt an ganzen Blättern
durchgeführt. In Abbildung 31E1-E3 sind Beispiele typischer Signale
der [18O] O2-Aufnahme von Fd I-„sense“- (S138) und Fd
I-„anti­sense“-Linien (A99) und Wildtyp-Kartoffelpflanzen in
Abhängigkeit von der Zeit dargestellt. Eine [18O2]-Aufnahme war
innerhalb der ersten 45 Sekunden nach Belichtungsbeginn bei kei­ner
der untersuchten Pflanzen zu beo­bachten. Im weiteren zeitlichen
Verlauf setzte bei den Wildtyp- und „sense“-Pflanzen eine deut­liche
Aufnahme ein, die bei den „sense“-Linien um eine Minute verzögert und
mit einer höheren Rate (abzuleiten aus der Kurvensteigung) auftrat.
Der Unterexprimierer A99, hier als extremstes Beispiel herangezogen,
zeigte demgegenüber nur einen minimalen Anstieg der O2-Aufnahme. Diese
O2-Aufnahme-Kurven gleichen bei sämtlichen untersuchten Pflanzen dem
zeitabhängig ermittelten Anstieg der CO2-Assimila­tionsraten
(s. Abb. 31A). Da weiterhin alle Unterschiede zwischen
Wildtyp-Pflanzen, Über- und Unterexprimierern ebenfalls mit den
entsprechenden Unter­schieden in den Assimilations­raten
übereinstimmten, ist die hier ermittelte O2-Aufnahme mit hoher
Wahrscheinlichkeit der parallel einsetzenden Photorespiration
zuzuordnen. Unter der Annahme, daß die Photorespira­tion mit einer
Rate von 5 µmol O2-Aufnahme  m-2  s-1 abläuft liegt die Rate der
Mehler-Reak­tion während der frühen Induktionsphase bei dem extrem
geringen Wert von 0,1 µmol O2-Reduktion  m-2  s-1, der unterhalb der
Detektionsgrenze anzusiedeln ist.
3.3 Herstellung und Charakterisierung von FTR B-„sense“- und
-„anti­sense“-Kartoffelpflanzen
FTR stellt die direkte Verbindung von der Elektronentransportkette zu
den über den Thiol-Disulfid-Wechsel regulierten Enzymen des Stroma,
wie z.B. NAD(P)-GAPDH, FBPase, SBPase, PRK und NADP-MDH, her. Das
Enzym überträgt die von Fd stammenden Elektronen auf spezifische Td,
welche ihrerseits regulatorische Disul­fidbrücken in den Zielenzymen
redu­zieren. Im Licht findet gleichzeitig auch immer eine
Re-Oxida­tion der gebildeten Sulf­hydrylgruppen statt. Durch diesen
Reduktions-Oxidations-Zyklus, der durch Stoffwechselin­termediate
beeinflußt wird, erfolgt die Einstellung von Aktivierungszu­ständen
einiger Enzyme. Neben dieser Funktion beeinflussen die Td auch die
Expres­sion von Chloroplasten-kodierten Enzymen und scheinen die
Aktivitäten von regulativ wirkenden Kinasen zu verändern. Aus diesen
Fakten wird deutlich, daß (1) der Re­doxzustand der Td auf
verschiedenen Ebenen rein regulatorische Funktionen hat, und daß (2)
FTR eine zentrale Stellung in der Verteilung der durch den
photosynthetischen Elektro­nentransport bereitgestellten Elektronen
auf die Td hat.
Über die Konstruktion von transgenen Kartoffelpflanzen mit erhöhten
bzw. gedrosselten Gehalten an FTR steht dann ein Untersuchungssystem
zur Verfügung, an dem nicht-invasiv der Einfluß variierter FTR-Mengen
auf die Aktivierung der Zielenzyme, die jeweils zugehöri­gen
Intermediatgehalte und die Elektronenumverteilung auf andere,
ebenfalls an den linearen Elektronentransport gekoppelte Reaktionen
untersucht werden können.
Zunächst wurde ein heterologer Ansatz gewählt: Die A. tumefaciens-vermittelte
Transformation von Kartoffelblattstückchen erfolgte mit dem in den
pflanzlichen Expressions­vektor pDE1001 in „sense“- und
„antisense“-Orientierung inserierten cDNA-Klon aus Spinat, der für die
Unter-einheit B des Enzyms kodiert (freundlicherweise von E.
Falkenstein zur Ver­fügung gestellt; Falkenstein et al. 1994). Nach
Regeneration und Anzucht in Erde konnten einige Indi­viduen mit
gedrosselten sowie auch erhöhten Gehalten an FTR B selektiert werden.
Durch extre­men Schädlingsbefall war es zu diesem Zeitpunkt nicht
möglich die Pflanzen bis zum Ende einer Wachstumsperiode zu erhalten
und dann wieder aus keimfähigen Knollen zu vermehren. Zur Be­wahrung
dieser transgenen Linien erfolgte eine Regeneration der Pflanzen aus
dem schon gebil­deten Knollenmaterial über einen zweiten
Gewebekulturschritt. Interes­santerweise zeigten sämtli­che zuvor
eindeutig identifizierten Unterexprimierer diesen Effekt anschließend
nicht mehr (Daten nicht gezeigt), wobei die gefundene Überexpression
un­beeinflußt blieb (Ergebnisse s. Kap. 3.3.7). Um nun aber
Pflanzenmaterial zu erhalten, das eine stabile Unterexpression des
inserierten Gens zeigt, sollte die Expression im homologen System
erfolgen. Für die Realisation dieses Projektes mußte der bislang noch
nicht bekannte cDNA-Klon der Untereinheit FTR B aus Kartoffel isoliert
werden. Parallel dazu wurde der für die Untereinheit A kodierende
cDNA-Klon identifiziert, da bis dahin nur Sequenzinformationen von
wenigen Spezies, wie dem Cyanobak­terium Anacystis nidulans (Szekeres et al. 1991),
der C3-Pflanze Spinacia oleracea (Falkenstein et al. 1994) und der
C4-Pflanze Zea mays (Iwadate et al. 1996) vorlagen.
3.3.1 Isolierung von ftr a-cDNA-Sequenzen aus Kartoffelblatt
In einem ersten Ansatz erfolgte die Amplifikation eines ca. 380
bp-Fragmentes in PCR-Reak­tionen, in welche als Matrize
einzelsträngige Kartoffel-cDNA zusammen mit dem Oligonukleo­tid-Paar
PFL014 (32-mer, Sinnstrang) und PFL023 (30-mer, Gegenstrang) gege­ben
wurde. Der Einsatz dieser Oligonukleotide führte in unserer
Arbeitsgruppe schon zur er­folgreichen Isolierung des ftr a-cDNA-Klons
aus einer Spinat--ZAP-cDNA-Bank (Falkenstein et al. 1994). Das
Kartoffel PCR-Fragment wurde in PCR-Reaktionen radioaktiv markiert und
als homologe Sonde zum „screening“ einer -ZAP-cDNA-Bank aus Kartoffel
eingesetzt. In der Erst-Runden-Plattierung konnten annähernd 50
positive Signale detektiert werden, von denen 15 gestochen und in
einer zweiten Runde vereinzelt wurden. Letzlich wur­den elf positive
Klone nach in vivo-Exzision zu­nächst einer Restriktionsanalyse
unterzogen. Nach Verdau mit der Restriktionsendonuklease EcoRI ergaben
sich Fragmente mit Längen von 1200 bp, 1050 bp und 750 bp. Zwei Klone
mit ca. 1200 bp-Inserts wurden einer Sequenz­analyse unterzogen. Die
erhaltene Basensequenz zeigte weder auf Nukleotidebene noch in der
davon abgeleiteten Aminosäuresequenz irgendeine Ähn­lichkeit zu schon
bekannten Sequenzen der Untereinheit A (Daten nicht gezeigt). Daher
wurden für den zweiten Ansatz zur Isolierung des Gens zunächst neue
Oligonukleotide konstruiert, wobei primär relativ konservierte
Sequenzbereiche aus Spinat und der zwischenzeitlich von Iwadate et al. (1996)
publizierten Proteinsequenz aus Zea mays als Grundlage dienten. Mit
diesen Oligonukleotiden konnte in PCR-Reaktionen dann eine Teilsequenz
von etwa 143 bp aus einzelsträngiger Kartof­felblatt-cDNA amplifiziert
werden, die nach Insertion in den Vektor pBSK und Vermehrung in E.
coli sequenziert wurde. Die von vier Transformanten erhaltenen
Nukleotidsequenzen sowie das verwendete Oligonukleotidpaar sind in
Abbildung 32 dargestellt. Die cDNA-Fragmente, hier als PCRA1 (143 bp),
PCRA7 (138 bp), PCRA19 (133 bp) und PCRA28 (142 bp) bezeichnet, waren
zwischen den Oligonukleotid­bereichen identisch und wiesen im Bereich
der Oligo­nukleotide Abweichungen auf, welche auf den hohen Grad der
Degeneriertheit zurückzuführen sind (SIM 1; 1:1024; SIM 2; 1:8192).
S IM 1 AAACAATACGTITGIGTNTGGAAAGGNAA 29mer (1:1024)
G G T G T G
PCRA1 ..A..G..T..GG.GG.A.....G..T.. XCAAATATCAGCTAATTTGCCTTACAAGGTG
PCRA7 G..C..GT.GG.G.....G..G.. X..............................
PCRA19 ..G..G..T..GG.GG.C.....G..G.. X..............................
PCRA28 ..G..A..T..GT.GG.G.....A..G.. X..............................
Q I S A N L P Y K V
PCRA1 CAGTTCGTGGTAGACGATTTGGAAGGACGAAGTACTCCGGTTAAGTTCTCTGCC ..CC.T
PCRA7 ...................................................... ..CC.T
PCRA19 ...................................................... ..TC.C
PCRA28 ...................................................... ..CC C
S IM 2 CACCTN
TT
Q F V V D D L E G R S T P V K F S A
PCRA1 CGC..A..C..A..C..GT.CA. 143 bp
PCRA7 CGC..G..C..G..C..GT.CA. 138 bp
PCRA19 CGA..G..C..G. 133 bp
PCRA28 CGC..G..C..G..C..GT.CA 142 bp
S IM 2 CGNGAAGAIGAATTIGAATTIGT 29mer (1:8192)
A G G GA A
Abbildung 32: Nukleotidsequenzen der mittels PCR amplifizierten ftr a-cDNA-Fragmente
und der verwendeten Oligonukleotide.
PCRA1, PCRA7, PCRA19 und PCRA28 bezeichnen die cDNA-Fragmente und SIM
1 bzw. SIM 2 die verwendeten Oligonukleotide. X stellt die
eingeschobenene Base dar, die in der abgeleiteten Aminosäure­sequenz
einen durchgehenden Leserahmen ermöglicht, I = Inosin, N = A, C, G
oder T
Die Übersetzung in die Aminosäuresequenz ergab bei allen
PCR-Fragmenten nach dem Oligo­nukleotid SIM 1 einen Sprung im offenen
Leseraster, der durch den Einschub eines Platzhal­ters (in Abb. 32 als
X gekennzeichnet) beseitigt werden konnte. Der Vergleich mit den
Protein­sequenzen der variablen Untereinheit A aus Mais und Spinat
ergab eine recht hohe Identität von 60% bzw. 52% und eine 100%ige
Übereinstimmung in der Lokalisation von in allen Orga­nismen
beschrie­benen konservierten Aminosäureresten. Daher wurde davon
ausgegangen, daß es sich bei der ge­fundenen Teilsequenz um ein
Fragment der ftr a-Kartoffel-cDNA handelt.
Dieses wurde dann für die Analyse einer Kartoffelblatt -ZAP-cDNA-Bank
eingesetzt und führte zur Identifikation von elf positiven Klonen, von
denen exemplarisch zwei einer Sequenzanalyse unterzogen wurden.
3.3.2 Isolierung von ftr b-cDNA-Sequenzen aus Kartoffelblatt
Analog zur Isolierung des für die Untereinheit A kodierenden
cDNA-Klons, wurde die Isolie­rung des cDNA-Klons für FTR B aus einer
Kartoffelblatt-cDNA-Bank durchgeführt. Zu­nächst erfolgte die
Amplifikation einer Teilsequenz aus einzelsträngiger Kartoffel-cDNA
(s. Kap. 2.19) mittels PCR-Reaktionen (s. Kap. 2.20) unter Verwendung
des Oligonukleotid­paares PFL015 (Sinnstrang) und PFL024 (Gegenstrang;
s. Tab. 2), welches ebenfalls zur Iden­tifizierung des cDNA-Klons aus
einer Spinat cDNA-Bank genutzt wurde (Falkenstein et al. 1994). Auf
diese Weise konnte ein ca. 260 bp-Fragment amplifiziert wer­den. Nach
Insertion des Fragmentes in den Vektor pBSK und Vermehrung in
XL1-blue-Zellen folgte eine Sequenzanalyse. Da ein Fragment eine hohe
Ähnlichkeit zu bekannten FTR B-Sequen­zen aufwies, wurde es in
PCR-Reaktionen mit [32P]-dATP markiert (s. Kap. 2.22) und als
homologe Sonde für die Analyse einer Kartoffelblatt- ZapII-cDNA-Bank
eingesetzt (freundlicherweise von Dr. U. Sonnewald, Gatersleben,
überlassen) (s. Kap. 2.23). Die Isolierung und nachfolgende in vivo-Exzision
der sieben positiven Klone erfolgte wie in Kapitel 2.23 und Kapitel
2.24 beschrieben.
3.3.3 Sequenzanalyse der isolierten ftr a-cDNA-Klone aus Kartoffel
Nach in vivo-Exzision wurden die mit EcoRI/NotI-Adaptern versehenen
cDNA-Klone durch Re­striktion mit NotI in einem Agarosegel
elektrophoretisch auf ihre Länge analysiert. Dabei traten folgende
Varianten in Erscheinung: Fünf der elf isolierten Klone konnten mit
NotI nicht ausge­schnitten werden, zwei wiesen eine Länge von ca. 1900
bp auf (ftra5, ftra14), vier Klone waren ca. 800 bp lang (ftra1, ftra3,
ftra11, ftra16) und ein Klon zeigte eine Länge von ca. 600 bp (ftra8).
Die Klone mit einer Länge von ca. 800 bp wurden einer Sequenzanalyse
unter­zogen. Alle vier untersuchten cDNA-Klone mit einer Länge von
695 bp wiesen eine identische Nukleotidsequenz auf und stellen, wie
aus Vergleichen der abgeleiteten Aminosäuresequenz mit denen aus
anderen Pflanzen deutlich wurde, vollständige cDNA-Klone dar, die mit
hoher Wahrscheinlichkeit für die Untereinheit FTR A kodieren. Die
Nukleotid- und abgeleitete Amino­säuresequenz des cDNA-Klons ftra1 ist
in Abbildung 33 dargestellt. Die Basenfolge um das dem 5’-Ende am
Nächsten liegende und als Startkodon angenommene ATG stimmt mit dem
für viele pflanzliche Gene ge­fundenen Konsensus-Motiv Pu-X-X-ATG-Pu
für die Initia­tion der Translation überein (Lütcke et al. 1987). Der
offene Leserahmen endet mit einem Stopkodon an Nukleotidposition 514
und ent­spricht somit einem Polypeptid von 171 Amino­säuren Länge. Die
ersten 59 Aminosäuren stellen vermutlich die für den Transport über
die Chloroplastenhüll­membran notwendige Transitsequenz dar, wonach
die Spaltstelle zwischen Lysin 59 und Serin 60 liegen würde. Diese
Annahme wird von dem Befund gestützt, daß die Aminosäurefolge in
diesem Bereich, mit einem Isoleucin bzw. Serin in Position -3 bzw. +1
weitestgehend dem Motiv (Ile/Val)-X-(Ala/Ser/Cys)(Ala/Ser/Cys/Met)
entspricht, wel­ches für einen hohen Prozentsatz von kernkodierten,
aber im Chloroplasten lokalisierten Proteinen beschrieben wurde (Gavel & von
Heijne 1990). Im Gegensatz zu der abgeleiteten Sequenz aus Spinat (Falkenstein et al. 1994)
und der aus Mais isolierten und mittels Edman-Abbau be­stimmten
Aminosäuresequenz (Iwadate et al. 1996) würde die reife
FTR A-Untereinheit aus Kartoffel mit einem Serin anstatt einem
Glutamin beginnen.
-27 AGAAATCTTGTATTAACCAGAATCACCATGACTGCTTCTACTTCAGCTTTCTTCTCATCA
M T A S T S A F F S S +11
+34 TCAATTCTCAACATACCCAATTCCAAGAACCAATCCCTCATCATCCCATCTCACAAGAAC
S I L N I P N S K N Q S L I I P S H K N +31
+94 ATCTTAAACCCTAACCCTTTTACCCAAATCAAGATTCATAAATCAAGAAACCCACAAAAG
I L N P N P F T Q I K I H K S R N P Q K +51
+154 CCAAATGGGTATTTCATTTCTAAGTCTGTGACTGTCGATAACCCCTCCACTGTTTCTTCT
P N G Y F I S K S V T V D N P S T V S S +71
+214 ACATCTTCGTTGAGTGTAGATGAGGGAGTTGATGAAAAAGATGCTGCGGCAATGGGGAAA
T S S L S V D E G V D E K D A A A M G K +91
+274 GTTGGGTCTAAGGTTAGGGTTACAGTTCCGTTGAAAGTGTATCATGAGCCGAAGGTTCCA
V G S K V R V T V P L K V Y H E P K V P +111
+334 GAATTGGATTTGGATGGGAGAATTGGGACAGTGAAACAGTATGTGGCTGTTCATAAAGGG
E L D L D G R I G T V K Q Y V A V H K G +131
+394 AAACAAATATCAGCTAATTTGCCTTACAAGGTGCAGTTCGTGGTAGACGATTTGGAAGGA
K Q I S A N L P Y K V Q F V V D D L E G +151
+454 CGAAGTACTCCGGTTAAGTTCTCTGCCCACCTTAAGGAAGATGAGTTTGAGTTTCTTGAT
R S T P V K F S A H L K E D E F E F L D +171
+514 TGATCCATTTCAGTTTTGATCACAATTTAATTGCTTTTTAATGAACTCAGTGTACTTCTG

+574 AATATATGAAAATAATCATGTGTACAAGTATTGTTTTGTGTATCATTTTGTAGATTTCAT
+634 TTTTGAAATAAAAAAATGCTTACTTTAGTTCAAAG
Abbildung 33: Nukleotid- und abgeleitete Aminosäuresequenz des für
FTR A kodierenden vollständigen cDNA-Klons ftra1 aus Kartoffel.
Die Nukleotidpositionen sind links, die Aminosäurepositionen sind
rechts vermerkt. Start- und Stop-Sequen­zen für die Translation sind
fett gedruckt, der Beginn des reifen Proteins ist durch einen
vertikalen Pfeil ge­kenn­zeichnet. 5’- und 3’-untranslatierte Bereiche
sind kursiv dargestellt.
In der Aminosäurekomposition enthält das Transitpeptid einige typische
Elemente, wie den hohen Anteil von 22% an Hydroxyaminosäuren (Serin:
zehn Reste; Threonin: drei Reste) und das vollständige Feh­len von
negativ geladenen Aminosäuren (Keegstra et al. 1989; von Heijne 1992).
Mit je 13,5% stellen die hydrophobe Aminosäure Isoleucin und die
ungeladene Aminosäure Asparagin (je acht Reste) die zweit-häufigsten
Vertreter dar. Ungewöhnlich hoch ist der Anteil der basischen
Amino­säure Lysin (sechs Reste) von 10%, die in vielen der
unter­suchten chloroplastidären Präsequenzen eher selten vorhanden
ist, da es sich bei diesem Rest um einen starken Helixbildner handelt
(Gavel & von Heijne 1990). Deutliche Unterschiede sind in der
Zusammensetzung des N-Termi­nus, der aus 14 ausschießlich hydrophoben
Resten besteht, zu verzeichnen. Im Rest der Sequenzerweiterung sind
Bereiche mit polaren Resten (Rest 15-22; Rest 44-53) und unpolaren
Resten (Rest 23-28; Rest 54-58) periodisch durchsetzt, wobei ein
Mittelstück (Rest 29-43) eher gemischt polar/unpolar vorliegt.

A:
Kartoffel --SVTVDNPSTVSSTSSLSVDEGVDEKDAAAMGKVGSKVRVTVPLKVYHEP--KVPELDL
56
Mais ----------EVAS-------DDVAAEEAAAAPKIGRRVRVTAPLRVYHVL--KAPDLDI 41
Spinat 1 EVALKSDSSTGFDSSSSS--PPEEDEELKKNLEKVGCKVKVKSPLKVYHVP--KLPEVEL
56
A. nidulans --------------------------------MNVGDRVRVKESVVVYHHPDHRNQAFDL
28
::* :*:*. .: *** : .::

Kartoffel D-GRIGTVKQYVAVHKGKQISANLPYKVQFVVDDLEGRSTPVKFSAHLKEDEFEFLD-
112
Mais Q-GMEGVVKQYVCVWKGKRVTANFPFKVEFELA-VEGQPKPVRFFAHLREDEFEFVDG 97
Spinat 1 TPDMVGVIKQYVGFWKGKYISPNYPFKVEYRID-VPDRGS-VKLVVHLKEEEFEIIAE
112
A. nidulans K-DAEGEIAAILTEWNGKPISANFPYLVSFSNK----------FRAHLRDFELEVI--
73
. * : : :** ::.* *: *.: : .**:: *:*.:

B:

Kartoffel MTASTSAFFSSSILNIPNSKNQS---LIIPSHKNILNPNPFTQIKIHKSRNPQKPNGYFI
57
Spinat 1 MTTGVAVMSSATAASTATATAAATARIPLFLSRNNSSATVCSTLRCRTITRTRTRARLAI
60
**:..:.: *:: . ..:. : : : :* ... : :: :. ..:. *
Kartoffel SKSVTVDNPSTVSSTSSLSVDEGVDEKDAAAMGKVGSKVRVTVPLKVYHEPKVPELDLD-
116
Spinat 1 CCEVALKSDSSTGFDSSSSSPPEEDEELKKNLEKVGCKVKVKSPLKVYHVPKLPEVELTP
120
. .*::.. *:.. ** * **: : ***.**:*. ****** **:**::*
Kartoffel GRIGTVKQYVAVHKGKQISANLPYKVQFVVDDLEGRSTPVKFSAHLKEDEFEFLD- 171
Spinat 1 DMVGVIKQYVGFWKGKYISPNYPFKVEYRIDVPDRGS--VKLVVHLKEEEFEIIAE 174
. :*.:****.. *** **.* *:**:: :* : * **: .****:***::
Abbildung 34: Aminosäuresequenzvergleich von verschiedenen reifen (A)
und nicht-prozessierten (B) FTR A-Untereinheiten.
A: Die abgeleitete Aminosäuresequenz aus Solanum tuberosum (Kartoffel,
diese Arbeit) wurde mit den FTR A-Sequenzen aus Spinacia oleracea
(Spinat 1, Falkenstein et al. 1994), Zea mays (Mais, Iwadate et al. 1996)
und Anacystis nidulans (A. nidulans, Szekeres et al. 1991) verglichen.
Identische Aminosäuren sind durch einen Stern, hochkonservierte
Aminosäuren sind durch einen Doppelpunkt und konservierte Aminosäuren
sind durch einen Punkt gekennzeichnet. Lücken, die durch den Prozeß
der com­putergestützten Analysen entstanden, sind durch Bindestriche
dargestellt (Programm: ClustalW, s. Kap. 2.30). : von Iwadate et al. (1996)
beschriebene Konsensussequenz-Domänen. Aminosäuren, die in die
Interaktion mit FTR B involviert sind, sind gelb unterlegt und
Aminosäuren, die an der Ausbildung des hydrophoben Kerns des Dimers
beteiligt sind, sind schwarz unter­legt (beschrieben von Dai et al. 2000b
für Synechocystis). Histidin 102 (gelbe Schrift, schwarz unterlegt)
scheint an beiden Arten der Interaktion betei­ligt zu sein. B:
Vergleich der Präproteine aus Kartoffel und Spinat (Spinat 1,
Falkenstein et al. 1994). Die putativen Spaltstellen sind fett
gedruckt.
Das resultierende reife Protein besteht demnach aus 112
Aminosäureresten und die rechnerisch ermittelte Molekülmasse beträgt
dann 12,7 kDa. Dies entspricht den für die FTR A2-Unterein­heit aus
Spinat ermittelten Ergebnissen (Falkenstein et al. 1994). Die auf
Proteinebene be­stimmte Mais-Sequenz besteht aus nur 97
Aminosäureresten (Iwadate et al. 1996) und die aus Anacystis nidulans
isolierte ftr a-cDNA-Sequenz kodiert für ein Protein von 73
Aminosäuren Länge (Szekeres et al. 1991). Wie aus dem Sequenzvergleich
hervorgeht, besteht selbst zu den reifen Proteinen anderer Arten die
sehr geringe Identität zwischen 25% und 47% (s. Tab. 5).
Tabelle 5: Prozentuale Identität einiger bekannter
FTR A-Aminosäuresequenzen in Bezug auf die abgelei­tete
Kartoffelsequenz.
Die Berechnung der Werte für die Präproteine, die reifen Proteine und
die Transitsequenzen, erfolgte mit Hilfe des Programms „LALIGN“ (s.
Kap. 2.30). Referenzen: s. Abbildung 34
Präprotein
Reifes
Protein
Transit-
Peptid
Kartoffel
100
100
100
Spinat
32
43
11
Mais
-
47
-
A. nidulans
-
25
-
3.3.4 Sequenzanalyse der isolierten ftr b-cDNA-Klone aus Kartoffel
Nach in vivo-Exzision der sieben positiven Klone wurden die
inserierten cDNA-Fragmentlän­gen mittels NotI-Verdau und
Agarosegelelektrophorese analysiert. Sechs Klone wiesen ein­heitlich
ein Insert zwischen 1600 bp und 1700 bp auf, und ein Klon enthielt ein
Fragment von ca. 550 bp Länge. Eine weiterführende Untersuchung dieses
Klons erfolgte auf Grund der ge­ringen Größe nicht. Die Sequenzanalyse
von zwei ausgewählten Klonen (ftrb1 und ftrb5) wurde durchgeführt,
indem zum einen interne Oligonukleotide (PFL081 und PFL082) verwen­det
und zum anderen von diesen Klonen Deletionsklone (BamHI, XhoI, PstI)
hergestellt wurden.
GCCGCCCGGGGACAAAGTTTGTGGCGAAAGCCAAGCGTTGTTGTTAACGGGGTCTGCAAG
GTGGTCAGCAAGGTTCTCCAATGGACCCTTTCCGGTAACAATGGCCTGAACGAAGAATCC
AAACATAGAGAACATAGCAAGTCTGCCGTTCTTAATCTCCTTTACTTTGAGCTCAGCAAA
TGCCTCTGGGTCTTCAGCAAGGCCTAATGGGTCAAAGCTGCCACCAGGGTAGAGTGGGTC
GACAACCTCACCAAGAGGTCACCAGCAATACGGTAACCTTCAACGGCTCCATCAATGACA
ACTTGGCAAGCCCAGATGGCCAAGATGCTCTGTGCATGGACCAAGCTTGGGTTGCCCAAG
TAGTCAAGTCCACCCTCGCTGAAGATGTGGGATCCGGCCTTGAACCACACAGCCTCACCG
AACTTGACACCATTACGGGCCAATAGCTCAGGGAAGACACATCAAGAGCACCAAGCATAG
CCATCTGCAGTGGATCACCTCGAGTTCACGGTTCTTGGCAAAGGTTTCAGGGTCTGCTGA
AAGTCCAGCGGTATCCCACCCGTAGTCACCAGGGAATTCACCGGTCAAGTAGCTTGGGGA
CTCACCAGAGAATGGGCCCAAGTACTTAACACGGTCAGGGCATACCATGGGCTGCTAGAT
GGGGCAGACTTGGCGACAGCTTTCTCATAGTGATCCTTCCANNN
-131 GAGCCATTGTAGCAGCTGCCATGGTTTATAAAGAGAGGAAGTTGTGGTGGTTAACAGAAT
-71 CACATTTTTGATTCAATCGGAAAGTAGGAGCGAAAAACGAGATAACGAAGCAATAACAGC
-11 CGGAATCCGCCATGAGAACTCTTCAAGCTTCCACCTCCTACAGCGTTGGCTTTGGAATTT
M R T L Q A S T S Y S V G F G I S +17
+49 CATCTTTTGCTACTCGTCCTAAGCCTTCTACTCATCGCTGCCTCACCGTAGCCAAAATGG
S F A T R P K P S T H R C L T V A K M E +37
+109 AGCCATCAGAGAAATCTGTTGAAATCATGAGGAAATTCTCGGAGCAGTATGCTCGCAGGT
P S E K S V E I M R K F S E Q Y A R R S +57
+169 CAGAAACATATTTCTGCATGGACAAAGGTGTTACTTCTGTGGTCATCAAGGGTTTGGCAG
E T Y F C M D K G V T S V V I K G L A E +77
+229 AGCACAAGGATACATTGGGCGCTCCACTCTGCCCCTGCAGGCATTATGATGACAAAGCTG
H K D T L G A P L C P C R H Y D D K A A +97
+289 CAGAAGCGCAGCAGGGCTTCTGGAATTGTCCATGTGTACCAATGAGAGAGAGGAAGGAGT
E A Q Q G F W N C P C V P M R E R K E C +117
+349 GTCACTGCATGCTTTTTCTGACCCCTGATAATGATTTTGCTGGAGAAGAACAGACAATTT
H C M L F L T P D N D F A G E E Q T I S +137
+409 CTATGGAGGAGATTAAGGAAACAACAGCCAACATGTGATGCTCGGACATCTTATACATGC
M E E I K E T T A N M  +148
+469 TATGAACATTACGTTTTTGTTGTACATGTATGTTTGCCTTGTAGATGAACGCAGCCAACA
+529 ATCCAAAGTTCTGATGTGGCATGTTGCTGAAACCCCATCCATTACATTGTTGTGATTCTG
+589 ATCTCGTCAAATGAGCTTGGGTGGGTGAATACCAGAGTGCAATTATGCTAACTGTTGTGT
+649 GATGCATCTAGATTGTACGAGTCAGTAATAGGGGATTTTGGGTAGCTTCAGCTAATGCAA
+709 ATCCTGATTTTGTATAAAACGGGAATCAATTTCCAATAGCTGCTTTGTGAAGTTCAATCC
+769 CCAGGCGCCTGACGTGTTAATAATGAAA
Abbildung 35: Nukleotid- und abgeleitete Aminosäuresequenz des für
FTR B kodierenden vollständigen cDNA-Klons aus Kartoffel.
Die Nukleotidpositionen sind links, die Aminosäurepositionen sind
rechts vermerkt. Start- und Stop-Sequen­zen für die Translation sind
fett gedruckt, der Beginn des reifen Proteins ist durch einen
vertikalen Pfeil ge­kenn­zeichnet. Konservierte Cysteine sind
unterstrichen. Die 5’- und 3’-untranslatierten Bereiche sind kursiv
darge­stellt. Die im 5’-Bereich eingefügten N beschreiben eine bis
dato noch nicht bestimmte Anzahl von Basen.
Die identischen Nukleotidsequenzen von ftrb1 und ftrb5 besitzen eine
bis zu diesem Zeitpunkt bestimmte Länge von 1626 bp (s. Abb. 35). Im
Vergleich zu den anderen ftr b-cDNA-Sequenzen hat der
Kartoffel-cDNA-Klon einen extrem verlängerten 5’-untranslatierten
Bereich, in dem sich im Bereich von Position –131 eine unbestimmte
Anzahl an Basen nicht bestimmen ließen (s. Abb. 35). Dieses 5’-Ende
konnte keinem Protein zugeordnet werden, da alle drei Leseraster
keinen offenen Leserahmen ergaben (Daten nicht gezeigt).
Der kodierende Bereich ist vollständig in der 3’-Region des isolierten
cDNA-Klons lokalisiert und beinhaltet einen offe­nen Leserahmen von
459 Nukleotiden. Das nach der Stopsequenz (Position -18 bis -16)
folgende, erste ATG wurde als Initiationskodon für die Translation
fest­gelegt, da es mit einer Purinbase in Nukleotidposition -3 und
Position +4 den Anforderungen eines starken Startkodons entspricht (Lütcke et al. 1989).
Die Nukleotidsequenz kodiert für ein Polypeptid mit einer Länge von
148 Amino­säuren.
Aus dem Vergleich mit anderen bislang bekannten, reifen
FTR B-Sequenzen ergab sich eine hohe Identität auf Aminosäureebene
(80%-89%), wodurch verifiziert werden konnte, daß der in dieser Arbeit
isolierte cDNA-Klon für die heterologe Untereinheit aus Kartoffel
kodiert (s. Abb. 36, Tab. 6).

A: Transitpeptide
Spinat MKALQASTSYSF-FSKSSSATLQR-RTHRPQCVILSK--- 35
Kartoffel MRTLQASTSYSVGFGISSFATRPKPSTHR--CLTVAK--- 35
Soja MTTQAST------FAVAVPSVATPFRRHRNPFVVRAQ--- 31
Mais MTSTVTTTVGCGGLPVRPLSTATRGRPRR--CAVRAQAAG 38
* : :: : :. * ::
B: Reife Proteine
Soja ---AEPS-DKSVEIMRKFSEQYARKSGTYFCVDKGVTSVVIKGLADHKDTLGAPLCPCRH 56
Spinat ---VEPS-DKSVEIMRKFSEQYARKSGTYFCVDKGVTSVVIKGLAEHKDSLGAPLCPCRY 56
Kartoffel ---MEPS-EKSVEIMRKFSEQYARRSETYFCMDKGVTSVVIKGLAEHKDTLGAPLCPCRH
56
Mais ---ADASNDKSVEVMRKFSEQYARRSNTFFCADKTVTAVVIKGLADHRDTLGAPLCPCRH 57
Synechocystis MTSSDTQNNKTLAAMKNFAEQYAKRTDTYFCSDLSVTAVVIEGLARHKEELGSPLCPCRH
60
:.. :*:: *::*:****::: *:** * **:***:*** *:: **:******:
Soja YDDKAAEVAQGFWNCPCVPMRERKECHCMLFLTPDNDFAGNEQTITLDEIKESTANM- 113
Spinat YDDKAAEATQGFWNCPCVPMRERKECHCMLFLTPENDFAGKDQTIGLDEIREVTANM- 113
Kartoffel YDDKAAEAQQGFWNCPCVPMRERKECHCMLFLTPDNDFAGEEQTISMEEIKETTANM-
113
Mais YDDKAAEVAQGFWNCPCVPMRERKECHCMLFLTPDNDFAGKDQVISFEEIKEATSKF- 114
Synechocystis YEDKEAEVKNTFWNCPCVPMRERKECHCMLFLTPDNDFAGDAQDIPMETLEEVKASMA
118
*:** **. : ***********************:*****. * * :: :.* .:.:
Abbildung 36: Aminosäuresequenzvergleich von verschiedenen
FTR B-Untereinheiten.
Die abgeleitete Aminosäuresequenz aus Kartoffel (diese Arbeit) wurde
mit den FTR B-Sequenzen aus Glycine max (Soja: Raeber et al. 1998),
Spinacia oleracea (Spinat: Falkenstein et al. 1994), Zea mays (Mais,
Marc-Martin et al. 1993) und Synechocystis sp. Stamm PCC6803 (Kaneko et al. 1995)
verglichen. Alle Sequenzen wurden als cDNA-Klone isoliert. Identische
Ami­nosäuren sind durch einen Stern, hochkon­servierte Aminosäuren
sind durch einen Doppelpunkt und konservierte Aminosäuren sind durch
einen Punkt gekennzeichnet. Lücken, die durch den Prozeß der
computergestützten Analysen entstanden, sind durch Bindestriche
dargestellt (Programm: ClustalW, s. Kap. 2.30). A: Sequenzver­gleich
der FTR B-Transitpep­tide. B: „Alignment“ der reifen FTR-Proteine.
Aminosäuren, die in die Interaktion mit FTR A involviert sind, sind
gelb unterlegt und Aminosäuren, die an der Ausbildung des hydrophoben
Kerns des Dimers betei­ligt sind, sind schwarz unterlegt (beschrieben
von Dai et al. 2000b für Synechocystis). Cysteine, die das
Fe-S-Zentrum binden, sind rot unterlegt mit schwarzer Schrift,
Cysteine der redox-aktiven Disulfidbrücke sind rot unterlegt mit
weißer Schrift.
Da das Enzym im Kerngenom kodiert ist, seine Funktion als
Elektronenüberträger aber im Stroma des Chloroplasten ausführt, muß in
der abgeleiteten Aminosäuresequenz des Kartoffel-cDNA-Klons eine
Präsequenz enthalten sein, welche dem translatierten Protein den
Übertritt über die Hüllmembran ermöglicht. Die exakte Festlegung der
Spaltstelle ist schwierig, weil das in vielen Präproteinen enthaltene
Konsensus-Motiv (Val/Ile)-X-(Ala/Ser/Cys)(Ala/Ser /Cys/ Met) (Gavel & von
Heijne 1990, vgl. auch Kap. 3.3.3) nur unvollständig vorhanden ist.
Auf Grund von Sequenzvergleichen zwischen der über
Proteinsequenzierung bestimmten Amino­säure­folge von FTR B aus Spinat
(Chow et al. 1995) mit den abgeleiteten Sequenzen aus Spinat (Falkenstein et al. 1994)
und Mais (Marc-Martin et al. 1993) wurde die Prozessierungs­stelle
zwischen Lysin 35 und Methio­nin 36 angenommen. Die Signalsequenz
besteht dement­sprechend aus 34 Aminosäuren und ent­hält, wie für
Transitpeptide typisch, einen hohen Anteil an Serin- (17,6%  sechs
Reste) und Threo­ninresten (14,7%  fünf Reste). Auffällig ist die
fast vollständige Identität der zehn N-terminalen Reste der
Kartoffelsequenz mit der Spinatse­quenz. (vgl. auch Abb. 36A und Tab.
6).
Die reife FTR B aus Kartoffel setzt sich demnach aus 113 Aminosäuren
zusammen, was einem errechneten Molekulargewicht von 12,7 kDa
entspricht. Der Wert ist identisch mit dem von Falkenstein et al. (1994)
und Chow et al. (1994) für die Spinatuntereinheit ermittelten Wert.
Die hohe Identität in der Primärstruktur (s. Tab. 6) bestätigt den
Befund, daß die FTR B-Untereinheit in allen Pflanzen stark konserviert
ist (Droux et al. 1987). Während die auf Amino­säureebene be­stimmte
Sequenz aus Spinat acht Cysteine beinhaltet, wurden in sämtli­chen
anderen Sequenzen nur sieben Cysteine gefunden, die aber an strikt
konservierten Positi­onen stehen. Die Cysteine an Aminosäureposition
54 und 84 bilden die redox-aktive Disul­fidbrücke des aktiven Zentrums
und die Cysteine an Position 52, 71, 73 und 82 binden das
[4Fe-4S]-Zentrum (Chow et al. 1995).
Tabelle 6: Prozentuale Identität bekannter FTR B-Aminosäuresequenzen
in Bezug auf die abgeleitete Kartoffelsequenz.
Die Berechnung der Werte für die Präproteine, die reifen Proteine und
die Transitsequenzen, erfolgte mit Hilfe des Programms „LALIGN“ (s.
Kap. 2.30). Referenzen: s. Abbildung. 36.
Präprotein
reifes
Protein
Transit-
Peptid
Kartoffel
100
100
100
Spinat 1
77
86
43
Spinat 2
70
80
51
Mais
64
80
18
Soja
75
89
31
3.3.5 Bestimmung der apparenten Molekulargewichte der FTR A- und
FTR B-Unter­einheiten aus Spinat- und Kartoffelpflanzen
Als Voraussetzung für eine quantitative Bestimmung endogener FTR A-
und FTR B-Gehalte in Kartoffelpflanzen mit veränderten FTR B-Mengen
war es notwendig, im Vorfeld einige Untersu­chungen an
Wildtyp-Pflanzen durchzuführen, die Aufschluß über folgende
Sachver­halte geben:
 apparentes Molekulargewicht von FTR A und FTR B in Kartoffel
verglichen mit den Unterein­heiten aus Spinat
 Kreuzreaktivität von Untereinheit-spezifischen Antikörpern in beiden
Pflanzenarten
Für die Immundetektion standen jeweils polyklonale Antikörper für die
beiden Untereinheiten aus Spinat zur Verfügung, die mit Hilfe der
rekombinanten Proteine hergestellt worden waren. Der Nachweis erfolgte
in Blattextrakten von Spinat- und Wildtyp-Kartoffelpflanzen (s. Kap.
2.13). Jeweils 100 µg lösliches Gesamtprotein wurde mittels SDS-PAGE
aufgetrennt und nach Protein­transfer auf Nitrozellulosemembranen
wurden diese mit anti-FTR A-, anti-FTR B- und anti-FTR A- plus
anti-FTR B-Antiseren in jeweils 1:500 Verdünnung inkubiert. Auf den
„Immunprints“ konnte eine wesentlich schlechtere Kreuzreaktion der
Spinat-Antise­ren mit den jeweiligen Untereinheiten aus Kartoffel
gezeigt werden (s. Abb. 37). Weiterhin traten deutliche Unterschiede
im apparenten Molekulargewicht auf (s. Abb. 37). Die Auftra­gung der Rf-Werte
gegen den dekadischen Loga­rithmus der Molekulargewichte der
Standard­proteine ergab in Spinatblattextrakten für die FTR A- bzw.
FTR B-Untereinheit ein apparentes Molekulargewicht von 17,4 kDa bzw.
14,1 kDa. In Kartof­felblattextrakten lagen die sehr spezifisch
detektierten Banden für FTR A bei 16,4 kDa und für FTR B bei 15,5 kDa,
so daß verglichen mit Spinat das Molekulargewicht von Kartoffel-FTR A
um 1,0 kDa geringer und FTR B um 1,4 kDa höher bestimmt wurde. Aus der
cDNA-Sequenz abgeleitet, sollten sich jedoch in beiden Pflanzenarten
identische Werte für beide Unter­einheiten ergeben (FTR A: 112
Aminosäuren, 12,7 kDa; FTR B: 113 Aminosäuren, 12,7 kDa)
(vgl. Kap. 3.3.4 und 3.3.3).

FTR B
FTR A+B
FTR A
(kDa)
1 2 3 4 5 6 MW

66


45

36
29
24

20.1
14.2

Abbildung 37: Vergleichende „Western Blot“-Analyse zwischen den FTR A-
und FTR B-Untereinheiten aus Proteinrohextrakten von Kartoffel und
Spinat-Blattgewebe.
Gesamtprotein (100 µg/Spur) von Blattextrakten (Spinat: Spur 1, 3 und
5; Kartoffel: Spur 2, 4 und 6) wurden über ein 20%iges
diskontinuierliches SDS-Gel getrennt und elektrophoretisch auf eine
Nitrozellulosememb­ran überführt. Die Inkubation erfolgte mit
Antikörpern (1:500 verdünnt) gegen Spinat-FTR A (Spur 1-2), -FTR A
plus -FTR B (zu gleichen Teilen gemischt) (Spur 3-4) und -FTR B (Spur
5-6). MW: Molekulare Mas­senstandards wie Abbildung 16.
Die anhand der Molekulargewichtsstandards bestimmten, wesentlich höher
liegenden Werte wei­sen auf ein anomales Laufverhalten der
FTR-Untereinheiten in SDS-haltigen Gelen hin (s. Abb. 37). Somit kann
vom apparenten Molekulargewicht in SDS-haltigen Gelen kein direkter
Rückschluß auf das tatsächliche Molekulargewicht der Untereinheiten
des Enzyms erfolgen. Eine Abhängigkeit des apparenten
Molekulargewichts vom Gradienten des benutzten Gels, sowie an­deren
spezifischen Standards wurde von Droux et al. (1987a) beschrieben.
Diese Autoren ermit­telten für FTR B aus Spinat, Mais und Nostoc 13
kDa und für FTR A 16 kDa, 15 kDa bzw. 7 kDa. Die Differenz in den
apparenten Molekulargewichten bietet gerade für das „screening“
transgener Pflanzen den Vorteil, daß immer zwischen den Untereinheiten
aus Spinat und Kartoffel unter­schieden werden kann, d.h. bei
Expression des Transgens ist dadurch eine direkte Identifizierung der
transferierten Untereinheit aus Spinat in transgenen Kartoffelpflanzen
möglich.
3.3.6 Konstruktion transgener Kartoffelpflanzen mit erhöhten und
erniedrigten endo­genen Gehalten an FTR B
Für die Herstellung von transgenen Kartoffelpflanzen, die eine
rekombinante FTR B-Unterein­heit überexprimieren, erfolgte aus den in
Kapitel 3.2.3 zur Konstruktion von Fd I-Überexpri­miern dargelegten
Gründen die Transformation von Kartoffelblattstückchen mit einer
hetero­logen ftr b-cDNA aus Spinat. Um eine stabile Reduktion im
FTR B-Gehalt zu erreichen, wurde die homologe cDNA aus Kartoffel
verwendet. Für den Agrobacterium tumefaciens-vermittel­ten Gentransfer
wurde die ftr b-cDNA aus Spinat bzw. die ftr b-cDNA aus Kartoffel
(diese Arbeit) unter Kontrolle des konstitutiven CaMV35S-Promotors in
„sense“- bzw. „antisense“-Orientierung in den binären Vektor pDE1001
kloniert (s. Kap. 2.29).
Das „screening“ der regenerierten Transformanten auf erhöhte bzw.
gedrosselte FTR B-Protein­niveaus wurde nach Anzucht in Erde im
Gewächshaus mittels „Western Blot“-Analyse durchgeführt (s. Kap.
2.13). Um einen Einfluß von somatischen Va­ria­tionen, welche nach
Regeneration von Pflanzen in Gewebekultur beobachtet wurden (Masle et al. 1993),
auf die Ergebnisse auszuschließen, wurden diese Versuche an aus
Knollen und unter kontrollierten Bedingungen in einer Klimakammer
(s. Kap. 2.2.2.2) gezogenen FTR B-Über­exprimierern wiederholt.
Sämtliche Folgeexperimente, wie Überprüfung der Transkript­menge
(s. Kap. 2.26) und der Einfluß von erhöhtem CO2 während des Wachstums
auf diesen Para­meter, erfolgten ebenfalls an diesen Pflanzen. Im Fall
der mit dem Kartoffel-„antisense“-Konstrukt trans­for­mierten Pflanzen
erfolgte auch die „Northern Blot“-Analyse an primären Regeneranten, da
noch keine keimfähigen Knollen zur Verfügung standen.
3.3.7 Molekulare Analyse von Spinat-FTR B-überexprimierenden
Kartoffelpflanzen
Die Expression von Spinat-ftr b-cDNA in „sense“-Orientierung in
Kartoffelpflanzen führte bei 32 von insgesamt 41 getesteten
Regeneranten zu einer bis zu ca. dreifachen Erhöhung gegen­über der in
Wildtyp-Pflanzen detektierten Proteinmenge (s. Abb. 38A). Dies
entspricht dem hohen Anteil von 78% der insgesamt getesteten Pflanzen.
Die FTR B-Überexprimierer wurden in zwei Gruppen eingeteilt: 1.
Überexpression von 100-150% des Wildtyp-Niveaus (z.B. FTR B S213) und
2. 150-300% des Wildtyp-Niveaus (z.B. FTR B S104). Bei allen
Übe­rexprimierern wurde eine von der Intensität vergleichbare
Markierung der kartoffeleigenen FTR B-Unterheit gefunden. Somit hatte
die Expression des heterologen Gens aus keinen Einfluß auf die
gebildete Menge der endogenen FTR B-Untereinheit. Für die Individuen
der Gruppe 2 (hoch exprimierende Linien) wurde ein Expressionsniveau
der transformierten FTR B-Untereinheit aus Spinat detektiert, das mit
dem der Wildtyp-Spinatpflanzen vergleich­bar war (zu unterscheiden an
den verschiedenen apparenten Molekulargewichten).

A
(kDa)
: 1 2 3 4 5 6 7 MW


B
WT
S104
S213
Spinat
(kDa)
: 1 2 3 4 5 6 7 MW
Abbildung 38: Immunologischer Nachweis von FTR A- bzw.
B-Untereinheiten in Blattextrakten von FTR B-Überexprimierern im
Vergleich zu Wildtyp-Kartoffelpflanzen und Spinat.
Je Spur wurden 75 µg Gesamtprotein aufgetragen und mit Antikörpern
gegen FTR B (A) oder FTR A (B) be­handelt. Spur 1 und 2:
Wildtyp-Kartoffelpflanze; Spur 3 und 4: transgene Linie FTR B S213;
Spur 5 und 6: transgene Linie FTR B S104; Spur 7: Spinat; Spur 8:
Molekulare Massenstandards (s. Abb. 16).
Demgegen­über wiesen die transgenen Linien der Kategorie 1 (moderat
exprimierende Linien) etwa 30% der in Spinat nachgewiesenen
Proteinmenge auf. Deutlich erkennbar ist, daß in allen Trans­formanten
das Molekulargewicht der exprimierten Spinat-Untereinheit B gleich war
und wie für Wildtyp-Spinat gezeigt bei 14,1 kDa lag (vgl. auch Kap.
3.3.5). Aus diesem Befund wurde gefolgert, daß die nach Transkription
im Cytosol als Präprotein vorliegende FTR B-Unterein­heit über die
Chloroplastenhüllmembran transportiert und die Transitsequenz
abgespalten wurde. Um Aufschluß über den endogenen Gehalt der
Untereinheit A zu erhalten, wurden parallel „Immunprints“ mit den
gleichen Blattproben angefertigt, die mit dem Antikörper gegen FTR A
behandelt wurden (s. Abb. 38B). In sämtlichen FTR B-Überexprimierern
lag die markierte FTR A-Proteinmenge auf gleichem Expressionsniveau
wie in den Wildtyp-Kartof­felpflanzen.
Zur Charakterisierung der ftr b- und ftr a-Transkriptmengen in den
oben vorgestellten FTR B-Überexprimierern im Vergleich zu
Wildtyp-Kartoffelpflanzen sowie Kontroll-Spinatpflanzen wurden
„Northern Blots“ mit Gesamt-RNA aus Proben des jeweils drittjüngsten
Blattes herge­stellt. Wie aus Abbildung 39A deutlich wird, lag nach
Inkubation mit [32P]-markierten-cDNA-Klon aus Kartoffel in der
transgenen Linie FTR B S104 ein stark erhöhtes Signal vor, während die
moderateren „sense“-Linien (z. B. FTR B S213) kaum eine Erhöhung
zeigten. Demgegen­über war die Erkennung zwischen der
Kartoffel-spezifischen Sonde und der mRNA aus Spinat sehr schwach. Mit
Hilfe der Standard-DNA-Fragmente wurde für das ftr b-Transkript beider
Pflanzen­arten eine Länge von 810 bp ermittelt. Anhand von
Testfiltern, die mit den im Vektor pBSK vor­liegenden cDNA-Klonen aus
Spinat und Kartoffel beträufelt wurden (0,1 pg-1 ng), konnte eine um
den Faktor 50-100 bessere Kreuzreaktion zwischen der Kartoffel-Sonde
mit dem homologen ftr b-Klon im Vergleich zum Spinat-Klon bestimmt
werden.
Da zu diesem Zeitpunkt die ftr a-Sequenz aus Kartoffel noch nicht zur
Verfügung stand, auf „Western Blots“ aber eine Erkennung zwischen dem
Spinat-Antikörper und der FTR A-Unter­ein­heit aus Kartoffel gefunden
wurde, erfolgte eine Rehybridisierung der Blots mit dem [32P]-mar­kier­ten
ftr a cDNA-Klon aus Spinat. Eine spezifische Markierung in Höhe von
810 bp erfolgte nur bei Spinatpflanzen (Daten nicht gezeigt). Dieses
Ergebnis bestätigt die schon nach Sequenz­ver­gleichen gefundene, sehr
geringe Identität zwischen ftr a-mRNAs verschiedener Spezies.


Sonde:
ftr b Spinat
32P-ftr b Spinat
ftr b Kartoffel
Spinat WT S104 S213 Klon-DNA 1 ng 0,1 ng 10 pg 1 pg

ftr b Spinat

Sonde:
32P-ftr b Kartoffel
ftr b Kartoffel
Spinat WT S104 S213 Klon-DNA 1 ng 0,1 ng 10 pg 1 pg
Abbildung 39: Analyse der ftr b- und ftr a-Expression in Spinat- und
Wildtyp-Kartoffelpflanzen im Ver­gleich zu Spinat-FTR B-überexprimierenden
Kartoffelpflanzen.
Gesamt-RNA (30 µg/Spur) von Wildtyp-Spinat- bzw. -Kartoffelpflanzen
und ausgewählten transgenen Linien von FTR B-überexprimierenden
Kartoffelpflanzen wurde in denaturierenden Agarosegelen aufge­trennt
und auf Nylonmembranen transferiert. Die Hybridisierung erfolgte
zunächst mit einem 32P-markierten 809 bp-HindIII-Fragment des ftr b-cDNA-Klons
aus Kartoffel. Nach Entfernen der Sonde wurde eine Re­hybridisierung
mit dem 32P-markierten Spinat-ftr b-cDNA-Fragment durchgeführt
(s. Kap. 2.21). Testfilter mit den angebenen Mengen an Plasmid-DNA
sind der jeweiligen Hybridisierung entsprechend neben den
Autoradiogrammen der RNA-Proben plaziert.
3.3.8 Molekulare Analyse von Kartoffel-FTR B-unterexprimierenden
Kartoffel­pflan­zen
Nach Regeneration auf Kanamycin-haltigen Medien erfolgte nach vier-
bis sechswöchiger An­zucht in Erde die Bestimmung der endogenen FTR
B-Gehalte von 96 unabhängigen Linien im Vergleich zu
Wildtyp-Kartoffelpflanzen mittels „Western Blot“-Analyse. Für die
Anfertigung der „Immunprints“ wurde ein polyklonales Antiserum gegen
die FTR B-Untereinheit aus Spinat ver­wendet. Von den getesteten
Pflanzen zeigten elf eine deutlich verminderte Signal­stärke,
entspre­chend 11,5 % der getesteten Pflanzen. Im Fall von vier
Individuen (FTR B A6, A50, A52, A111) lag der FTR B-Gehalt mit ca. 10%
der in Wildtyp-Pflanzen bestimmten Menge nahe der Detek­tionsgrenze.
Andere transgene Linien wiesen eine Reduktion um 50% auf (FTR B A18,
A20, A78, A91, A98, A100, A132). Die Ergebnisse für ausgewählte
trans­gene Linien sind in Abbildung 40 dargestellt. In Bezug auf
Wachstumsrate und phänotypisches Erscheinungsbild waren bei diesen
primären Transformanten keine Unterschiede zu
Wildtyp-Kartoffelpflanzen feststellbar (Daten nicht gezeigt).


66

29


(kDa)
WT A100 A18 A6 A50 A111 A20 WT MW

45
36
24
20.1
14.2
Abbildung 40: Immunologischer Nachweis von FTR B-Untereinheiten in
Blattextrakten von ausgewählten FTR B-Unterexprimierern im Vergleich
zu Wildtyp-Kartoffelpflanzen.
Je Spur wurden 150 µg Gesamtprotein aufgetragen und mit dem Antikörper
gegen Spinat-FTR B behandelt. Die Anzucht der Pflanzen erfolgte nach
Regeneration in Sterilkultur im Gewächshaus. Die verwendeten Linien
sind jeweils oben vermerkt. MW: Molekulargewichtstandards in kDa
(s. Abb. 16).
Die zur Überprüfung der ftr b-Transkriptmenge im Anschluß daran
durchgeführte „Northern Blot“-Analyse ergab ein vergleichbares Bild.
Eine extreme Verringerung der ftr b-spezifischen Markierungen wurde
z.B. für die Linien FTR B A50 und A111 gefunden (s. Abb. 41). In der
Kategorie der Unterexprimierer mit einer ca. 50%igen Reduktion der
FTR B-Proteinmenge traten Pflanzen mit ftr b-mRNA Mengen auf, die
ebenfalls um 50% verringert waren (z.B. A20).

30 µg 15 µg
WT A50 A20 A111

Abbildung 41: Analyse der ftr b-Expression in
Wildtyp-Kartoffelpflanzen im Vergleich zu ausgewählten transgenen
Kartoffelpflanzen.
Gesamt-RNA von Wildtyp-Kartoffelpflanzen (15 oder 30 µg/Spur) und
ausgewählten transgenen Linien FTR B-unterexprimierender
Kartoffelpflanzen (30 µg/Spur, verwendete Linien wie jeweils oben
angegeben) wurde in denaturie­renden Agarosegelen getrennt und auf
Nylonmembranen transferiert. Die Hybridisierung erfolgte mit dem 32P-markierten
ftr b-Fragment aus Kartoffel (s. Abb. 39).
4. Diskussion
Ziel der hier vorgestellten Untersuchungen war die Analyse des
Zusammenspiels zwischen dem photosynthetischen Elektronentransport und
den Elektronen-verbrauchenden Reaktionen im Calvin-Zyklus. Hierzu
erfolgten Manipulationen von Elektronen- und/oder
Metabolitver­fügbarkeit im Chloroplasten Die Elektronenverteilung
wurde unter besonderer Berücksichti­gung der redoxmodu­lierten Enzyme
untersucht, da die Aktivierung und Anpassung von ver­schiedenen im
Calvin-Zyklus lokalisierten Enzymen die Voraussetzung für eine an die
jeweili­gen Bedingungen ange­paßte CO2-Fixierung ist. Dazu wurden drei
voneinander verschiedene Ansätze gewählt:
· Isolierte Spinat-Chloroplasten wurden mit sättigendem Licht (700 µE)
bestrahlt; nach Errei­chen des „steady state“ wurden verschiedene
Elektronenakzeptoren zugesetzt.
· Isolierte Spinat-Chloroplasten wurden mit steigenden
Lichtintensitäten (0-700 µE) be­strahlt; eine Änderung stromaler
Intermediatspiegel wurde durch Zugabe von verschiede­nen, spezi­fisch
auf die einzelnen Enzyme wirkenden Komponenten erzielt.
· Zur Analyse der Elektronenflüsse im intakten Blatt wurden die
endogenen Gehalte des zentra­len Elektronenverteilers Fd I durch
„sense“- und „antisense“-Transformation mit den entspre­chenden
cDNA-Sequenzen variiert. Als weiteres Untersuchungsmaterial wurden
transgene Pflanzen hergestellt, welche FTR, eine Komponente des
Fd-Td-Systems, über- bzw. unter­exprimieren. Auf diese Weise sollte
der Elektronenfluß auf die entsprechenden Zielenzyme des Calvin-Zyklus
verändert werden.
In diesen Ansätzen wurden die Auswirkungen auf verschiedene Schritte
der Photosynthese ver­folgt, beginnend mit der
Elektronentransportkette; weiterführend wurden die im Stroma
ablaufen­den Reaktionen untersucht.
4.1 Regulation der Photosynthese unter variierendem Elektronenangebot
und Wechselwirkung von Metaboliten mit reduktiver Aktivierung
4.1.1 Auswirkung von Elektronenakzeptoren auf die Photosynthese und
die Aktivie­rungszustände von redoxmodulierten Enzymen in isolierten
Chloroplasten
In Spinat-Chloroplasten war unter Kontrollbedingungen die
Lichtsättigung der Photosynthese ab einer Lichtintensität von ca.
300 µE erreicht. Ab dieser Lichtintensität war keine Steigerung der O2-Produkti­onsrate
mehr meßbar (s. Abb. 7A). Parallel dazu verlief die Sättigung des 14CO2-Einbaus
(s. Abb. 7B). Demgegenüber nahm der pH-Gradient über die
Thylakoid­membran, bestimmt als nicht-photochemische Löschung der
Chlorophyllfluoreszenz (qN, s. Abb. 7C) und der PS II-Elektronendruck,
bestimmt als photo­chemische Löschung der Chloro­phyllfluoreszenz (qP,
s. Abb. 7D) bei Erhöhung der Lichtintensi­tät auf 700 µE stetig zu,
während die Quantenwirksamkeit von PS II in gleichem Maße sank (fII,
s. Abb. 7E). Durch diese Messungen wird verdeutlicht, daß
Chloroplasten bei hohen Lichtintensitäten einen hohen Anteil der
eingestrahlten Lichtquanten nicht für die Assimilation von CO2 nutzen.
Eine Möglichkeit die überschüssigen Elektronen in isolierten
Chloroplasten für die Aufrechter­haltung eines für die CO2-Fixierung
optimalen ATP/NADPH-Verhältnisses schadlos umzuset­zen, ist die
Mehler-Reaktion. Eine während der Induktionsphase der Photosynthese
unter sätti­gendem Licht ablaufende O2-Reduktion, die zwischen 5% und
15% des gesamten Elektronen­flusses ausmacht, konnte
massensprektrometrisch nachgewiesen werden (Marsho et al. 1979, Badger
1985, Backhausen 1994), wenn keine zusätzlichen Elektronenakzeptoren
wie OAA in den Ansätzen vorhanden waren. Weiterhin zeigten
Untersuchungen mit Antimycin A, daß auch der zyklische
Elektronentransport in isolierten Chloroplasten mit hohen Raten
stattfindet (Woo 1983, Backhausen et al. 1994). Auch Steiger & Beck
(1981) wiesen ein paralleles Auftreten beider Reaktionen nach. Ein
weiterer relevanter Weg ist der kontinuierliche Elektro­nenfluß über
das Ferredoxin-Thioredoxin-System. Dadurch erfolgt die
Aufrechterhaltung so­wie die Einstellung der Aktivierungszustände
verschiedener Zielenzyme (Scheibe 1991). Die Quantifizierung des
Elekt­ronenbedarfs für diesen Weg ist schwierig. Die in dieser Arbeit
untersuchten Enzyme, wie NAD(P)-GAPDH, FBPase und PRK, sind im
Calvinzyklus lokali­siert. Der Fluß durch den Zyklus wird u.a. über
die Aktivitäten dieser Enzyme geregelt. Die ebenfalls untersuchte
NADP-MDH ist dem­gegenüber den „poising“-Mechanismen zuzuordnen
(s.u.).
Die Zugabe der verschiedenen Elektronenakzeptoren bei konstanter
Lichtintensität (700 µE) führte zu einer klaren Umlenkung der
Elektronenflüsse. Die dadurch hervorgerufenen Effekte auf die
Photosynthese können in zwei Gruppen eingeteilt werden: (1) ein
moderater, kontrol­lierter Elektronenverbrauch, der zu einer
Verschiebung der Flüsse führte, aber keine Hemmung der Photosynthese
zur Folge hatte, und (2) ein starker Elektronenentzug, der die
Photosynthese hemmte.
Als Beispiel für den ersten Fall können die Zugaben von 0,2 mM bzw.
2 mM OAA oder 0,2 mM Nitrit angeführt werden, da unter diesen
Bedingungen zwar eine Erhöhung von O2-Entwicklung und qP zu beobachten
war, aber qN überhaupt nicht und die stromalen
Metabolit­konzentrationen nur wenig beeinflußt wurden (s. Tab. 3).
Auch eine Störung der Reaktionen des Calvin-Zyklus kann weitestgehend
ausgeschlossen werden, da keine signifikante Beein­flussung der
Aktivie­rungszustände der redoxmodulierten Enzyme PRK, NAD(P)-GAPDH
und FBPase auftrat (s. Abb. 13). Die unter diesen Bedingungen
zugegebenen niedrigeren Konzent­rationen an OAA und Nitrit (auch in
Kombination) entziehen dem System offensichtlich nur Elektronen, die
nicht für die CO2-Assimilation und nicht für die Aufrechterhaltung des
Elekt­ronenflusses über das Fd-Td-Sys­tem auf die Zielenzyme benötigt
werden. Bei den hier ver­brauchten Elektronen handelt es sich um die
unter sättigendem Licht von der Elektronentrans­portkette
bereitgestellten „Überschußelektro­nen“.
Eine Abnahme des Enzym-Aktivierungszustandes relativ zur Kontrolle
wurde sowohl nach OAA-Zugabe als auch nach Zugabe von Nitrit (auch in
Kombination) nur für die NADP-MDH detek­tiert. Der Elektronenfluß auf
diese Akzeptoren bewirkt über zwei völlig voneinander verschiedene
Mechanismen die Abnahme des NADP-MDH-Aktivierungszustandes. Soweit
bekannt, unterliegt die Nitrit-Reduktion durch die Nitritreduktase
keiner enzymatischen Kon­trolle. Im Stroma vorhandenes Nitrit wird mit
höherer Präferenz als OAA umgesetzt (Backhausen 1994), wodurch eine
Akkumulation dieses für den Chloroplasten toxischen In­termediats
vermieden und die für die Pflanze essentielle N-Versorgung zum Aufbau
von Pro­teinen sichergestellt wird. Welche Menge an Elektronen für
diesen Stoff­wechselweg benötigt wird, ist somit einzig von der
Nitrit-Konzentration abhängig, d.h. mit stei­gender Konzentration im
Stroma werden auch steigende Mengen an Elektronen, die für andere
Reduktionen benötigt werden, entzogen. Dies führt dann unter Umständen
zur Hemmung der Photosynthese (s.u.). Die Stellung von Nitrit vor OAA
in der von Backhausen et al. (2000) aufgestellten Hierarchie der
Elektronenakzeptoren wird auch durch die kombinierte Zugabe von Nitrit
und OAA ver­deutlicht, die zu einer Verringerung der Malatbildung
führt, während die Nitritreduktion unter diesen Bedingungen
unbeeinflußt bleibt (Backhausen et al. 1994).
Der Umsatz von OAA und dementsprechend auch der Elektronenfluß durch
das Malatventil wird über die Regulation der NADP-MDH kontrolliert.
Neben der reduktiven Aktivierung durch Tdm, das den Anteil von
reduziertem Enzym einstellt, wird der resultierende
Aktivie­rungszustand des Enzyms durch das NADPH/NADP-Verhältnis sehr
fein reguliert (Scheibe 1984, Backhausen 1994, Faske et al. 1995). Ein
zu hoher Umsatz von NADPH führt durch steigende Konzentratio­nen an
NADP zu einer sofortigen Abnahme des Aktivierungszustandes, da NADP
die reduktive Aktivierung des Enzyms hemmt (Scheibe 1984). Da in vivo
Änderun­gen im ARC und im qP im­mer parallel auftreten, wird der
regulierende Effekt auf die Einstel­lung des Aktivierungszustandes
synergistisch verstärkt (Backhausen 1994, Kitzmann 1996, vgl. Tab. 3).
Der Aktivierungszu­stand der NADP-MDH ist somit immer ein guter
Indikator für den anliegenden Elektronendruck und den
Reduktionszustand des NADPH-„pools“. Für die Analyse der
Wechselwirkungen zwi­schen Elektronentransport, Metaboliten und den
redoxmo­dulierten Enzymen wurde der Aktivie­rungszustand der NADP-MDH
in der vorliegenden Arbeit aufgrund dieses Regulationsmechanis­mus
immer parallel zu denen der anderen Enzyme bestimmt. Dadurch sind
unter vielen Bedin­gungen die sehr zeitaufwendigen Quantifizierungen
der NADPH- und NADP-Gehalte ersetzbar. Da das Enzym sehr sensitiv
schon auf geringe Änderungen im NADPH/NADP-Verhältnis reagiert (vgl.
Tab. 3 und Holtgrefe et al. 1997), lassen sich über die Messung des
NADP-MDH-Aktivie­rungszustandes auch exaktere Aussa­gen über
Änderungen im NADPH/NADP-Verhältnis machen.
Der exzessive Elektronenentzug durch 2 mM Nitrit oder 10 µM
Methyl­viologen führte zu einer deutlichen Beeinflussung der
Photosynthese. Es trat eine Abnahme der stroma­len 3PGA-Kon­zentration
und des 3PGA-Exportes auf, während der stromale FBP-Gehalt, das
ATP/ADP-Verhältnis und qN stark anstiegen (vgl. Tab. 3). Die NADP-MDH-
und FBPase-Akti­vierungs­zustände nahmen direkt nach Zugabe von 2 mM
Nitrit (s. Abb. 13B und 13N) und von 2 µM oder 4 µM Methylviologen ab
(s. Abb. 13D und 13P), wäh­rend die Aktivierungszustände der
NAD(P)-GAPDH und der PRK unbeeinflußt blieben. Beson­ders der
verminderte Aktivie­rungszustand der NADP-MDH, der einen erhöhten
Elektronenumsatz im Stroma direkt an­zeigt, legt die Schlußfolgerung
nahe, daß die Inhibierung der Enzyme durch einen übermäßi­gen,
unkontrollierten Elektronenverbrauch durch die zusätzlichen Akzeptoren
her­vorgerufen wurde. Auch der Anstieg des stromalen FBP-Gehaltes bei
parallel sinkendem Aktivie­rungszu­stand der FBPase deutet auf einen
verringerten Elektronenfluß über das Fd-Td-System hin. Einen Anstieg
von Hexosephosphaten und RuBP in mit Methylviologen inkubierten
Spinat­blättern demonstrierten Neuhaus & Stitt (1989), woraus die
Autoren folgerten, daß beson­ders die Reaktionen der FBPase und SBPase
beeinträchtigt werden. So scheinen gerade die FBPase und die sehr
ähnlich regulierte SBPase (Laing et al. 1981; Wirtz et al. 1982) die
Kontrollstellen im Calvin-Zyklus darzustellen, da die
Aktivierungszu­stände der anderen unter­suchten und ebenfalls
redoxmodulierten Enzyme unverändert blieben (weiterführende
Diskus­sion s.u. im Kapitel).
Für die Effektoren Nitrit und Methylviologen müssen aber noch weitere
Interaktionen mit dem Plastidenstoffwechsel in Erwägung gezogen
werden. Die Zugabe von Methylviologen kann eine Schädigung von
Proteinen durch die bei dieser Reaktion entstehenden O2-Radikale
be­wirken (Kaiser 1976, 1979, Charles & Halliwell 1980). Über eine
Akkumulation von Nitrit im Stroma kann es zu einer Absenkung des
stromalen pH-Wertes kommen (Purczeld et al. 1978, Robinson 1988).
Besonders die reduktive Aktivierung der FBPase ist schon gegenüber
geringen pH-Wert-Senkungen empfindlich, da die Affinität von
reduziertem Td gegenüber der FBPase (Soulié et al. 1985) und die
Reaktivität von reduziertem Td an sich gesenkt wird (Scheibe et al. 1986).
Beide Elektronenakzeptoren führten aber zu identischen Ergebnissen,
nämlich der Ab­nahme der NADP-MDH- und FBPase-Aktivität, wobei für
Methylviologen keine Auswirkungen auf den stromalen pH-Wert bekannt
sind.
Für einen erhöhten Umsatz von Elektronen über Methylviologen, ohne daß
während dieser Kurzzeitmessungen eine extreme Schädigung der Enzyme
auftritt, spricht die Behandlung der Plastiden mit 2 µM Methylviologen
(s. Tab. 3). Diese Konzentration bewirkte eine etwa 50%ige Hemmung der
14CO2-Fixierung und einen mit den „stärkeren“ Elektronenakzeptoren
vergleichbaren Anstieg des pH-Gradienten, wäh­rend alle anderen
bestimmten Parameter ähn­liche Werte wie nach Zugabe der moderaten
Akzep­toren ergaben. Daß ein sehr großer Anteil der zur Verfügung
stehenden Elektronen offensichtlich für die Reduktion von
Methylviologen verwendet wird und somit nicht mehr dem Fluß über das
Fd-Td-System zur Verfügung steht, geht aus den erniedrigten
Aktivierungszuständen der NADP-MDH und der FBPase hervor.
Ein generelles Problem bei derart hohen Elektronenflüssen ohne
gleichzeitigen ATP-Verbrauch ist eine starke Ansäuerung des
Thylakoidlumens, welches zu einer pH-induzierten Abnahme der
PS II-Aktivität führen kann (Heber & Walker 1992, Krieger & Weis 1993)
und so eine Re­duktion des Elektronenflusses bewirkt. Die starke
Erhöhung der qN-Werte nach Zugabe der verschiedenen
Methylviologen-Konzentrationen und 2 mM Nitrit weisen auf eine
Regulation durch diesen Mechanismus hin. Eine partielle Entkopplung
des Elektronentrans­portes mit 1 mM NH4Cl in Ge­genwart von 10 µM
Methylviologen zeigte, daß die Restriktio­nen in der Photosynthese
haupt­sächlich auf eine pH-induzierte Inhibierung von PS II
zurück­zuführen sind (Kitzmann 1996). Nach NH4Cl-Zugabe stiegen der
pH-Wert im Thylakoid­lumen und auch die CO2-Fixierung zwar an, aber
sowohl der ARC mit Werten von 0,36 nach NH4Cl-Zugabe im Vergleich zu
0,48 unter Kontrollbedingungen als auch der Aktivierungs­zustand der
NADP-MDH blieben stark erniedrigt (Kitzmann 1996). Der steigende Fluß
durch den Calvin-Zyklus ist ein weiterer Hinweis dafür, daß
Methylviologen im Versuchszeitraum selbst in den hohen Konzentrationen
nicht zu einer irreversiblen Schädigung der Enzyme führt. Neben den
artifiziellen Effekten, die durch Methyl­viologen hervorgerufen werden
können, deutet dies auf eine Restriktion des Elektronenflusses in
Richtung NADP und Td hin.
Die Limitierungen im Calvin-Zyklus durch diese Elektronenakzeptoren
könnten dann auch durch eine verminderte Bereitstellung von NADPH
verursacht werden. Chloroplasten, deren Elektro­nentransport
vollständig entkoppelt wurde oder die osmotisch geschockt wurden und
denen dann Ferricyanid als Elektronenakzeptor angeboten wurde, wiesen
im Vergleich zu Chloroplasten, de­nen CO2 als Elektronenakzeptor
zugesetzt wurde, eine dreifach erhöhte O2-Produktionsrate auf (Backhausen
1994). Daraus geht hervor, daß Thylakoide über eine aus­reichende
Elektronen­transport-Kapazität verfügen und auch Chloroplasten die
Fähigkeit besit­zen, NADPH in hohen Raten zu bilden (Giersch et al. 1980).
Auch die Bestimmung der NADPH- und NADP-Konzen­tration ergab, daß
sogar in Gegenwart von 10 µM Methylviolo­gen oder 2 mM Nitrit nur
ge­ringfügige Abnahmen im ARC auftreten (s. Tab. 3). Diese waren so
gering, daß eine Beeinflussung des Cal­vin-Zyklus über die Funktion
von NADPH als Elektronendonor für die Reaktionen der NADP-MDH oder
NAD(P)-GAPDH oder von NADP als Elektronenakzeptor für die FNR wenig
wahr­scheinlich ist.
Eine Veränderung der NAD(P)-GAPDH-Aktivierungszustände war nach Zugabe
bis zu 4 µM Methylviologen und bei allen anderen zugegebenen
Elektronenakzeptoren nicht meßbar. Eine Feinregulation des Enzyms über
den Thiol-Disulfidaustausch scheint für die Einstellung der
Akti­vierungszustände im Licht von untergeordneter Bedeutung zu sein.
Erst eine vollständige Hem­mung des linearen Elektronentransportes mit
DCMU löst eine Abnahme des Aktivie­rungszustan­des auf ca. 50% des
unter Kontrollbedingungen bestimmten Wertes aus, so daß die Reduktion
hauptsächlich beim Licht/Dunkel-Übergang eine regulatorische Funktion
über­nimmt (Kitzmann 1996). Die Reduktion des im Dunkeln als 600
kDa-Hexadekamer vorlie­genden Enzyms steigert die Aktivität nicht
signifikant, aber erhöht die Sensitivität des Enzyms gegenüber der
Aktivierung durch 1,3-bisPGA, das nicht nur als Substrat im Licht
fungiert, sondern auch Aktivatorfunktion hat (Baalmann et al. 1994,
1995). So bewirkt 1,3bisPGA die Dissoziation des Enzyms in die
tetramere 150 kDa-Form, die eine hohe Affinität gegenüber 1,3bisPGA
und damit eine erhöhte spezifische Aktivität in vivo aufweist.
Änderungen des Ak­tivierungszustands im Licht sind dann auf Änderungen
im 1,3-bisPGA-Gehalt zurückzuführen. Die Konzentration von 1,3bisPGA
steht über die Reaktion der PGK im Gleichgewicht mit dem
ATP/ADP-Verhältnis und 3PGA, deren stromale Konzentrationen sich aber
unter allen hier untersuchten Bedingungen gegenläufig ver­halten
(s. Tab. 3). Dies bedeutet, daß bei hohen 3PGA-Konzentrationen immer
ein niedriges ATP/ADP-Verhältnis auftritt und umgekehrt. Dadurch, daß
die Reaktion der PGK nahe am ther­modynamischen Gleichgewicht liegt
und das Enzym jeweils äquivalente Mengen an PGA und ATP umsetzt (Robinson & Walker
1979), sind dann selbst unter extremen Bedingungen keine signifikanten
Änderungen in der stromalen 1,3bisPGA-Konzentration zu verzeichnen. So
bleibt auch der Aktivierungszustand der NAD(P)-GAPDH unverändert. Eine
vergleichbare Beziehung zwischen 3PGA und dem ATP/ADP-Verhältnis ohne
eine Auswirkung auf den Aktivierungszu­stand der NAD(P)-GAPDH
beobachteten Baalmann et al. (1995) nach Änderungen der Pi-Kon­zentrationen
im Inkubationsmedium. Die Abnahme der Aktivierung in Gegenwart von
10 µM Methylviologen ist wohl auf die aus den gemessenen 3PGA-, ADP-
und ATP-Gehalten errechnete etwa 40%ige Abnahme der
1,3bisPGA-Konzentration zurückzuführen (Kitzmann 1996). Dabei wurde
eine direkte Hemmung der NAD(P)-GAPDH durch zu geringe Verfügbarkeit
von NADPH ausge­schlossen, da die berechnete Konzentration von 80 µM
über dem Km-Wert des aktivierten Enzyms von 60 µM (Baalmann et al. 1995)
liegt (Kitzmann 1996).
Auch die PRK wies selbst nach Zugabe der „stärksten“
Elektronenakzeptoren keine Änderung im Aktivierungszustand auf. Bei
Belichtungsbeginn werden die regulatorischen Disulfidbrü­cken im Enzym
reduziert. Dieser Redoxwechsel des Enzyms geht dann mit der Änderung
der Aktivität einher (Porter et al. 1987). Eine Änderung im
Aggregationszustand über Assozia­tion bzw. Dis­soziation der
Untereinheiten scheint ebenfalls in diesen Prozess involviert zu sein,
wobei eine höher molekulare Form das inaktive Enzym repräsentiert (Porter et al. 1990).
Wie Untersuchun­gen am gereinigten Enzym ergaben, ist die Einstellung
der aktuellen Aktivierungszustände haupt­sächlich abhängig vom
Elektronendruck und wird von ATP in geringem Umfang positiv beeinflußt
(Faske et al. 1995). Eine Feinregulation im Licht erfolgt
ausschließlich auf Ebene der Ka­talyse, indem die Enzymaktivität, die
im Chloroplasten offensichtlich in großem Überschuß vor­handen ist,
durch Stroma-Metabolite gedrosselt wird. Aufzuführen sind 3PGA, FBP,
SBP, RuBP, 6-Phosphogluconat, ADP und Pi, wobei 3PGA, FBP,
6-Phosphogluconat und Pi in pH-abhängiger Weise hemmen (Gardemann et al. 1983).
Hemmungen durch diese Metabolite sind hier nicht zu erwarten, da
gegenläufige Änderungen in den Inhibitorkonzentrationen, wie z.B. das
erhöhte ATP/ADP-Verhältnis im Vergleich zu dem stark erniedrigten
3PGA-Gehalt, durch die Elektronen­akzep­toren hervorgerufen wurden.
Auch die unveränderte 1,3bisPGA-Reduktion deutet daraufhin, daß die
Limitierungen in der Photosynthese nicht auf die PRK zurückzuführen
sind. Deutlich geht aus den in dieser Arbeit durchgeführten Messungen
aber auch hervor, daß eine große Menge an Elektronen dem Zyklus
entzogen werden kann, ohne daß dies Auswirkungen auf den
Aktivierungszustand der PRK hat und daß dieses Enzym für die
Redox-Kontrolle des Calvin-Zyklus nur eine untergeordnete Rolle
spielt.
Demgegenüber weisen die vorliegenden Befunde immer weiter in die
Richtung, daß die FBPase am sensibelsten auf den Elektronenentzug im
Stroma reagiert. Die Einstellung des Aktivierungs­zustandes ist ein
kombinierter Effekt aus Reduktion der regulatorischen Disul­fidbrücken
und ei­nem positiven Effekt auf diese Aktivierung, der durch das
Substrat FBP bewirkt wird und das somit auch Aktivatorfunktion hat (Wolosiuk et al. 1980).
Wie am iso­lierten Enzym nachgewie­sen wurde, verschiebt FBP das
Gleichgewicht zwischen aktiver und inaktiver Enzymform in Richtung
aktives Enzym (Faske et al. 1995), so daß erhöhte FBP-Konzentrationen
im Stroma eine größere Enzymmenge in die aktive Form überführen
müssten.
Unter Kontrollbedingungen wurde ein stetiger Anstieg des
FBPase-Aktivierungszustandes in Abhängig­keit von der Belichtungszeit
beobachtet, der vermutlich durch den stetig zunehmen­den
Elekt­ronendruck (qP) in isolierten Chloroplasten ohne Zusatz von
weiteren Elektronenak­zeptoren verursacht wird. Nach Zugabe der
höheren Elektronenakzeptor-Konzentrationen wurde aber eine inverse
Beziehung zwischen FBPase-Aktivität und FBP-Gehalt gefunden (vgl. Tab.
3). Dies legt zunächst die Vermutung nahe, daß der Aktivierungszustand
des Enzyms im Chloroplasten hauptsächlich vom Elektronendruck abhängt.
Es besteht die Möglichkeit, daß durch zu starken Elektronenentzug der
Elektronenfluß über das Fd-Td-System soweit reduziert ist, daß keine
ausreichende Menge an Elektronen für die Aufrechterhaltung des
Redox-Zyklus vor­handen ist (vgl. NADP-MDH-Aktivierungszustände). Das
unter diesen Bedingungen durch die extrem hohen Elektronenflüsse
erhöhte ATP/ADP-Verhältnis und der erhöhte qN sprechen für eine
direkte Rückkopplung auf den photosynthetischen Elektronenfluß durch
die zuge­gebenen Akzeptoren (vgl. oben). Deutlich wird diese
Kontrollfunktion des ATP/ADP-Verhält­nisses wiederum durch die
Entkopplung des Elektro­nentransportes mit NH4Cl, das unter diesen
Bedingungen die Akkumulation von FBP zeitweilig verhindert (Kitzmann
1996). Über den Umsatz von FBP erfolgt dann wieder eine erhöhte
Regeneration des CO2-Ak­zeptors und ein Anstieg der CO2-Assimilation.
Der Anstieg des ATP/ADP-Verhältnisses stellt dann das Signal für eine
Anpassung des Elektronentransportes an die neue Stoffwechselsituation
dar (Holtgrefe et al. 1997). Diese Befunde deuten auf eine
herausragende Rolle des Enzyms in der redox-vermittelten Kontrolle der
CO2-Fixierung hin und demonstrieren den Zusammen­hang zwischen Redox-
und Energiestatus des Chloroplasten.
4.1.2 Bedeutung von variierenden Elektronenflüssen und Metaboliten für
die Regula­tion von Enzymen des Calvin-Zyklus
Aus den in Kapitel 4.1.1 diskutierten Befunden wird deutlich, daß ein
Elektronenentzug durch Zugabe von Elektronenakzeptoren nicht selektiv
eine Änderung ausschließlich in diesem Para­meter bewirkt. Neben den
Änderungen in den Photosynthese-Parametern ist eine Interaktion von
Nitrit und auch von den aus dem Umsatz von Methylviologen stammenden
Radikalen oder auch H2O2 unwahrschein­lich, aber nicht vollständig
auszuschließen. Diese Ergebnisse deuten aber auf eine besondere
Stellung der FBPase in der Kontrolle des Calvin-Zyklus hin. PRK und
NAD(P)-GAPDH dagegen spielen unter diesen Bedingungen offensichtlich
eine untergeord­nete Rolle. Um weitere Informationen über mögliche
Kontrollstellen im Calvin-Zyklus zu er­halten, wurde die
Wech­selwirkung zwischen reduktiver Aktivierung und den für diese
Enzyme relevanten Effektoren weiter aufgeschlüsselt. Dazu wurde zum
einen der Elektronendruck im Chloroplasten durch Belichtung der
Plastiden mit steigenden Lichtinten­sitäten verändert (s. Kap. 3.1.2).
Zum anderen erfolgte eine Manipulation der endogenen Metabolitgehalte;
in diesem Zusammenhang wurden wichtige Intermediate quanti­fiziert. Da
sämtliche Versuchsan­sätze auch eine Änderung des Elektronendruckes
verursachen, wurde parallel zu den Enzym­aktivierungszuständen der
Reduktionsgrad im Stroma über die Akti­vierungszustände der NADP-MDH
gemessen und der Reduktionsgrad der Elektronentransport­ketten über qP
be­stimmt.
Die in dieser Arbeit untersuchten Enzyme des Calvin-Zyklus, PRK,
NAD(P)-GAPDH und FBPase, wiesen in Abhängigkeit von der eingestrahlten
Lichtmenge ein völlig unterschied­liches Aktivierungsverhalten auf
(s. Abb. 8).
Die PRK benötigt nur geringe Lichtintensitäten (50 µE) für eine
100%ige Aktivierung (s. Abb. 8A). Dieses Enzym braucht im
Chloroplasten offensichtlich einen nur sehr geringen Elektro­nendruck,
damit die regulatorischen Disulfidbrücken im Enzym reduziert werden
und es in die aktive Form überführt wird. Eine Erhöhung des endogenen
ATP-Gehalts hatte keine Auswirkun­gen auf das Aktivierungsverhalten
und auch eine Erniedrigung der Triosephosphat-Konzentration durch
Zugabe von 2,2 mM Pi blieb ohne Effekt (s. Abb. 9D). Unter den hier
getesteten Versuchsbedingungen führte nur die Hemmung der ATPase durch
Tentoxin unter kombiniertem Zusatz von Pi vor Belichtungsbeginn zu
einer 40%igen Erniedrigung der Enzymaktivität. Tentoxin ist ein
potenter ATPase-Inhibitor, der schon in geringen Konzentra­tionen eine
fast 100%ige Hemmung hervorruft (Sigalat et al. 1995). Unter diesen
Bedingun­gen war allerdings auch keine O2-Entwicklung mehr meßbar.
Daher kann auf einen stark redu­zierten Elektronenfluß bei parallel
stark erniedrigten 3PGA- und DHAP-Gehalten und einer erhöhten
ADP-Konzentration im Stroma ausgegangen werden. Das System muß also
extrem ausgelenkt werden, bevor die Aktivierung der PRK beeinflußt
wird. Eine Abhängigkeit von der Lichtintensität wurde nicht
beobachtet. Nach Tentoxin-Zugabe war schon bei Lichtinten­sitäten von
50 µE eine ca. 25%ige Verringerung des Aktivierungszustandes zu
beobachten, der auch bei höheren Lichtintensitäten auf diesem Niveau
blieb. Vermutlich können die direkt nach Einschalten des Lichts noch
zur Verfügung stehenden Elektronen für die Einstellung dieses
Aktivierungszustandes genutzt werden, bevor der Elektronenfluß durch
Tentoxin stark herabgesetzt wird. Dies weist auf die Bedeutung der
Redox-Modulation nur während des Dun­kel-Licht-Übergangs hin und daß
Metabolite im Licht nur auf katalytischer Ebene wirksam werden
(vgl. Kap. 4.1.1).
Vergleichbar geringe Lichtintensitäten von ca. 50 µE sind ausreichend,
um die NAD(P)-GAPDH auf den unter Kontrollbedingungen maximal
möglichen Aktivierungszustand von 60-70% der Kapazität zu ak­tivieren
(s. Abb. 8B). Ebenso wie im Fall der PRK war über sämtliche
Lichtintensitäten eine ca. 20%ige Abnahme im Aktivierungszustand nur
durch die Zugabe von Tentoxin und Pi zu erreichen (s. Abb. 9C). Eine
alleinige Zugabe von Pi bewirkt über eine ge­genläufige Auslenkung von
3PGA-Konzentration und ATP/ADP-Verhältnis, ohne daß eine Änderung in
der 1,3bisPGA-Konzentra­tion und somit auch nicht im
Aktivierungszustand der NAD(P)-GAPDH zu verzeichnen war (Baalmann et al. 1995)
(vgl. Kap. 4.1.1). Die Abnahme des Aktivierungszustandes durch Zugabe
von Tentoxin plus Pi weist daraufhin, daß die reduk­tive Aktivierung
nicht beeinflußt wird, sondern eher eine starke Beeinträchtigung in
der 3PGA- und ATP-Bereitstellung zu einer verminderten
1,3bisPGA-Bildung durch die PGK führt und somit in der beobachteten
reduzierten NAD(P)-GAPDH-Aktivierung von 15-20% resultiert (vgl. 10 µM
Methylviologen, Kap. 4.1.1). Da unter diesen Bedingungen der
Elektronenfluß extrem reduziert ist, ist eine Feinregulation der
Enzymaktivität über das Ferredoxin-Thiore­doxin-System im Licht eher
auszuschließen, was sich somit mit den Befun­den nach Zugabe von
Elektronenakzeptoren während der „steady state“-Photosynthese deckt.
Die Reduktion des Enzyms direkt nach Belichtung hat, wie am isolierten
Enzym gezeigt (Baalmann et al. 1994), auch im Chloroplasten die
Funktion den Ka-Wert für 1,3bisPGA zu erniedrigen. Die Einstel­lung
der Enzymaktivität erfolgt dann über 1,3bisPGA (vgl. Kap. 4.1.1).
Von allen untersuchten Enzymen war wie schon in Kapitel 4.1.1
beschrieben nur der FBPase-Aktivierungszustand durch Mani­pulation des
für dieses Enzym relevanten Metaboliten FBP direkt beeinflußbar.
Anders als bei der PRK und NAD(P)-GAPDH verläuft der Anstieg des
Aktivierungszustandes der FBPase parallel mit dem Anstieg der 14CO2-Fixierungsrate
(vgl. Abb. 7C und Abb. 8D). Diese nicht neue Beobachtung, die aber für
das hier benutzte System eine wichtige Grundlage bildet und aus diesem
Grund untersucht wurde, deutet wieder auf die grundlegende Regulation
der FBPase durch reduktive Aktivierung abhängig vom Intermediat FBP
hin. Der stromale FBP-Gehalt wird während der Induktionsphase der
Photo­syn­these aufgebaut und die tatsächlich vorhandene FBP-Menge
zeigt dementsprechend eine starke Abhängigkeit von der eingestrahlten
Lichtmenge bzw. von der Elektronenverfügbarkeit (s. Abb. 11).
Wie am gereinigten Enzym nachgewiesen wurde, ist die Einstellung des
aktuellen Aktivie­rungs­zustandes abhängig vom aktuellen
Elektronendruck und der Menge an FBP (Faske et al. 1995). In
Abwesenheit des Effektors FBP führt auch die Inkubation des
gerei­nigten Enzyms mit Elektronendonor DTTred allein zu keiner
Aktivierung. Die Reduktion der FBPase in Gegenwart des
Substratana­logons CaFBP, das ausschließlich Aktivatorfunktion hat und
nicht durch das Enzym umgesetzt werden kann, bewirkt eine 100%ige
Aktivierung. Dies war auch möglich, wenn die Kon­zentration an DTTred
stark verringert wurde. Übertragen auf die in vivo-Situation bedeutet
dies, daß die Aktivierung des Enzyms in Gegenwart von FBP bei einer
viel geringeren Elektronenver­fügbarkeit erfolgen kann (Faske et al. 1995).
Im Chloroplasten ist die stromale Konzentration von FBP direkt an den
photosynthetischen Elek­tronentransport gekoppelt. Bei Belichtung der
Chloroplastensuspension mit verschiedenen Licht­intensitäten ist unter
Kontrollbedingungen ab einer Lichtintensität von 300 µE keine Änderung
im stromalen FBP-Gehalt mehr detektierbar. Dieser verläuft damit
parallel zu den gemessenen Aktivierungszuständen der FBPase
(s. Abb. 8D). Der FBP-Gehalt steigt von 1 nmol FBP · mg Chl-1 im
Dunkelansatz auf durchschnittlich 2,5 nmol FBP · mg Chl-1 bei 300 µE
bei einem Anstieg des Aktivierungszustandes von 0-5% auf 20-25% der
Kapazität. Die Erhöhung des FBP-Ge­haltes durch Vorinkubation der
Plastiden mit DHAP wirkte sich beson­ders bei niedrigen
Lichtin­tensitäten (25-150 µE), d.h. bei geringer
Elektronenverfügbarkeit, extrem auf den Aktivierungszu­stand der
FBPase aus. Schon bei sehr geringen Lichtintensitäten von 50 µE wurde
nahezu der unter Kontrollbedingungen gemessene
Maximalaktivierungs­zustand erreicht. Auch nach Errei­chen der
Lichtsättigung lag dieser Wert konstant ca. 5% über den in den
Kontrollen bestimmten Werten. Demgegenüber konnte nach Absenken des
stroma­len FBP-Gehaltes durch Vorinkubation der Plastiden mit Pi nur
eine marginale Aktivierung des Enzyms hervorgerufen werden
(s. Abb. 9B).
Derartige Eingriffe in den Plastidenstoffwechsel hatten auch immer
eine Steigerung des am PS II anliegenden Elektronendruckes (qP,
s. Abb. 10A) zur Folge. Gleichzeitig war die O2-Produktions­rate nach
DHAP-Zugabe verringert und nach Zusatz von Pi vollständig unterdrückt
(s. Abb. 10C). Dies weist auf einen stark verminderten bzw. fehlenden
Elektronentransport hin. DHAP bewirkte ebenfalls einen erniedrigten
intrathylakoidalen pH-Wert (s. Abb. 10B), was auf ein ebenfalls
verringertes ATP/ADP-Verhältnis hindeutet. Es kann unter diesen
Versuchs­bedingungen aber nicht unterschieden werden, ob eine
Beeinträchti­gung in der Bereitstellung von ATP oder ein erhöhter
Umsatz dieses Intermediats im Stroma dafür verantwortlich sind. Wie
aus den parallel bestimmten erhöhten NADP-MDH-Aktivierungszuständen
abzuleiten ist (s. Abb. 9A), ist der Redoxstatus im Stroma unter
diesen Bedingungen stark erhöht. Über den Regulati­onsmechanismus der
NADP-MDH, deren Aktivierung durch NADP gehemmt wird, kann auf ein in
beiden Fällen erhöhtes NADPH/NADP-Verhältnis zurückgeschlossen werden.
Die Erklärung dafür wäre dann, daß unter beiden Bedingungen ein Umsatz
des im Licht produ­zierten NADPH durch die NAD(P)-GAPDH unterdrückt
ist, da diese Reaktion im Plastiden den Hauptverbrauchsort für
Elektronen in Form von NADPH darstellt. Eine Inkubation mit DHAP führt
über den strikt mit Pi gekoppelten Gegen­tausch über den Pi-Translokator
zu einer Pi-Verarmung des Stroma. Dieses wird aber für eine
aus­reichende Synthese von ATP benötigt. Die zwar im Vergleich zur
Kontrolle verringerte aber den­noch signifikante O2-Freisetzungsrate
weist aber deutlich darauf hin, daß in einem gewissen Um­fang
Elektronen transportiert wer­den. Eine Erklärung für diesen Effekt
wäre ein Umsatz des DHAP hauptsächlich über den rege­nerativen Teil
des Calvin-Zyklus. Auf diese Weise würde dann durch den ATP-Verbrauch
durch die Reaktion der PRK das ATP/ADP-Verhältnis gesenkt und Pi für
die Neusynthese von ATP freigesetzt.
Bei Inkubation der Plastiden mit Pi hingegen verarmt das Stroma an
Triosephosphaten (GAP, DHAP) und 3PGA, mit der Konsequenz, daß die
Bildung von 1,3bisPGA weitestgehend unter­bleibt. Weiterhin wird nur
wenig FBP gebildet (s. Abb. 11), welches beim Umsatz durch den
regenerativen Teil des Calvin-Zyklus zur Bereitstellung von einer
ebenfalls geringen Menge 3PGA führt.
So resultiert sowohl die Zugabe von DHAP (s. Abb. 9A) als auch die
Zugabe von Pi (Daten nicht gezeigt) in einem erhöhten
NADPH/NADP-Verhältnis und in Folge dessen in einem er­höhten
Aktivierungszustand der NADP-MDH. Unterstützt wird dies durch die
Tatsache, daß der Aktivierungszustand der NADP-MDH nach Zugabe von
3PGA sinkt (s. Abb. 9A). Durch 3PGA erfolgt ein erhöhter Umsatz an
NADPH durch die NAD(P)-GAPDH, was dann einen Abfall im
NADPH/NADP-Verhältnis zur Folge hat. Dieser vermehrte
Elektronenverbrauch im Stroma wird durch einen verminderten
Elektronendruck am PS II, d.h. die qP-Werte sind er­höht, und durch
eine ebenfalls verminderte Ansäuerung des Thylakoidlumens
verdeutlicht.
Wie aus den Messungen mit zusätzlichen Elektronenakzeptoren deutlich
wurde (s. Kap. 4.1.1), führt der zu starke Elektronenentzug zu einer
Inhibierung der FBPase, obwohl unter diesen Bedingun­gen die
FBP-Konzentration stark anstieg. Die Erhöhung mittels DHAP bzw.
Ernied­rigung des FBP-Gehaltes mittels Pi hingegen führt zu einer
Erhöhung bzw. Erniedrigung des Aktivierungszu­standes. Daß die
Einstellung des Aktivierungszustandes, wie schon am gerei­nigten Enzym
gefun­den, aber einen kombinierten Effekt aus Elektronenverfügbarkeit
und FBP-Gehalt darstellt (Faske et al. 1995), wird sowohl von der
linearen Beziehung zwischen der FBP-Menge (s. Abb. 12A) und dem
Aktivierungszustand, als auch von der ebenfalls linea­ren Abhängigkeit
des Akti­vierungszustandes von qP unterstützt (s. Abb. 12B). Der
Aktivie­rungszustand der FBPase steigt mit Erhöhung der
Lichtintensität, die ihrerseits wiederum eine Erhöhung des
FBP-Gehaltes be­wirkt. Dabei ist eine Aktivitätszunahme in
Abhängigkeit vom Elektronendruck meßbar, die aber auf keinen Fall
unabhängig vom FBP-Gehalt ist. Bei Zusatz von Pi in das
Inkubationsmedium wird der Elektronendruck und der Redoxstatus im
Stroma stark erhöht, resultierend in der hohen NADP-MDH-Aktivierung.
Der Aktivierungszustand der FBPase hingegen war unter diesen
Bedingungen nicht zu steigern, da FBP als Aktivator nicht vorhanden
ist. Der aktivierende Effekt des Metaboliten FBP auf die FBPase wird
durch den Elektronendruck in der Weise beeinflußt, daß eine Erhöhung
der Lichtintensität in hö­heren Enzymaktivitäten unter vergleichbaren
FBP-Konzentrationen resultieren.
Dabei wurden zwei offensichtlich voneinander verschiedene
Aktivierungsverhalten beobach­tet: Bei den Lichtintensitäten von 10 µE
und 50 µE ergab sich ein linearer Zusammenhang und ein ebenfalls
linearer Zusammenhang war bei Intensitäten von 150-700 µE zu erkennen
(s. Abb. 12). Daraus kann die Schlußfolgerung gezogen werden, daß ein
bestimmter Elektro­nendruck mit der entsprechenden FBP-Menge vorhanden
sein muß, um eine größere Enzym­menge in die aktive Form überführen zu
können. Diese Aktivierung scheint bei einer limitier­ten
Elektronenverfügbar­keit dann unabhängig von FBP zu sein, d.h. die
Einstellung des Akti­vierungszustandes hängt vornehmlich von der
reduktiven Aktivierung ab. Andersherum kann das Enzym durch einen
ho­hen Elektronendruck allein, wie z.B. nach Zugabe von Pi, nicht in
die aktive Form überführt wer­den. Der jeweils resultierende
Aktivierungszustand weist auf ein feines Zusammenspiel zwischen
stromalem FBP-Gehalt und Elektronendruck hin. Keine der Komponenten
alleine ist in der Lage, eine signifikante Aktivierung zu induzieren.
Aus den Korrelationen zwischen der Aktivität und dem FBP-Gehalt bzw.
qP ist abzuleiten, daß sowohl für den Elektronendruck als auch für den
FBP-Gehalt ein Schwellenwert existiert, der über­schritten werden muß,
um eine größere Enzym­menge in die aktive Form zu überführen. Die
lineare Korrelation zwischen FBP-Menge und FBPase-Aktivität
demonstriert das Prinzip der „feed forward“-Modulation, während
offensicht­lich bei limitierter Substratverfügbarkeit eine
Rückkopplung auf den photosynthetischen Elektro­nentransport erfolgt.
Dieser Mechanismus ermöglicht eine optimale Anpassung der
Enzymaktivi­tät an die aktuellen Metabolit- und Lichtverhältnisse im
Chloroplasten und verhindert gleichzeitig bei einsetzender Belichtung
ein Absinken der Metabolitgehalte des Calvin-Zyklus.
4.2 Transgene Kartoffelpflanzen mit veränderten Gehalten an Ferredoxin
I
Sämtliche an Chloroplasten durchgeführten Experimente hatten neben den
gewünschten Effekten auch immer Auswirkungen auf verschiedene andere
Photosyntheseparameter. Der Chloroplast stellt ein isoliertes Organell
dar, an dem zwar viele Untersuchungen durchgeführt werden können.
Allerdings unterscheiden sich viele Photosynthesepara­meter in ganzen
Blät­tern von den in isolierten, intakten Chloroplasten bestimmten
Werten. Aufzuführen sind hier beispielsweise die Lichtsättigung der
Photosynthese, qP und auch qN (vgl. Abb. 10 und Abb. 30). In Blättern
ist der Elektronenfluß aber nicht so einfach manipulierbar wie an
Chloroplasten. Mit der Generierung von transgenen Kartoffelpflanzen,
die über einen intern ver­ringerten bzw. erhöhten Gehalt an Fd I
verfügen, sollte Pflanzenmaterial zur Verfügung stehen, an dem die
Auswirkung eines permanent veränderten Elektronenflusses im
Chloro­plastenstroma untersucht werden kann. Fd I wurde dafür
ausgewählt, da dieses Protein die zentrale Schaltstelle zwischen dem
photosynthetischen Elektronenfluß und den im Chloro­plastenstroma
lokalisierten verbrauchenden Stoffwechselwegen darstellt. Unbekannt
ist, wel­che Menge dieses zentralen Elektronenverteilers notwendig
ist, um sämtliche Wege mit Elektro­nen zu versorgen, oder ob dieses
Protein ebenfalls im Überschuß vorhanden ist, wie dies für viele
andere Enzyme des Calvin-Zyklus beschrieben wurde. Weiterhin sollte
anhand dieser Pflanzen untersucht werden, ob die für isolierte
Spinat-Chloroplasten beschriebene hierarchische Anordnung der
verschiedenen Elektro­nen-verbrauchenden Reaktionen (Backhausen 1994,
Backhausen et al. 2000) auch in vivo existiert.
4.2.1 Isolierung eines Fd I-Klons aus einer l-ZAP
cDNA-Kartoffelblattbank
In Experimenten, in denen Tabakpflanzen mit einem heterologen
„antisense“-Konstrukt der NADP-MDH (Faske et al. 1995) oder
Kartoffelpflanzen mit einem heterologen FTR-„anti­sense“-Konstrukt
transformiert wurden, war es nicht möglich, Pflanzen mit einem
signifikant und stabil reduzierten Gehalt der entsprechenden Proteine
zu regenerieren. Demgegenüber scheinen An­sätze, die mit den homologen
cDNA-Sequenzen transformiert wurden, erfolgver­sprechender zu sein,
wie dies z.B. im Fall der großen Untereinheit der RubisCO gezeigt
wer­den konnte (Quick et al. 1991).
Aus diesem Grund bestand der erste Schritt in der Isolierung des für
Fd I kodierenden Klons aus einer l-ZAP-cDNA-Kartoffelblattbank.
Kartoffelpflanzen sollten als Zielpflanze verwen­det wer­den, da diese
Pflanzen (1) über eine klare „sink-source“-Kompartimentierung verfügen
und (2) der interne Proteingehalt weniger starke Schwankungen in
Abhängigkeit von der Posi­tion des Blattes an der Pflanze, dem Alter
der Blätter und der ganzen Pflanze unterliegt (Faske 1996). Auch die
verschiedenen photosynthetischen Parameter sind über einen gewissen
Zeit­raum und über die gesamte Pflanze recht stabil (J. Backhausen,
persönliche Mitteilung). Vari­ationen in den angesprochenen Parametern
wurden für die Kapazität und die Aktivität der NADP-MDH in
Wildtyp-Tabakpflanzen beschrieben (Faske et al. 1995; Backhausen &
Scheibe 1998).
Wie in Kapitel 3.2.2 beschrieben, konnten vier unabhängige Klone
isoliert werden, von denen einer mit 144 Aminosäuren für die
vollständige Sequenz des Fd I-Polypeptids kodiert. Dieser Klon setzt
sich aus einem reifen Polypetid mit 97 Aminosäuren und einer
N-terminalen Prä­sequenz von 46 Aminosäuren zusammen (s. Abb. 14 und
Abb. 15). Letztere stellt höchstwahr­schein­lich die für den Transport
des Fd-Präproteins über die Chloroplastenhüllmembran not­wendige
Transitsequenz dar. Da ein weiter im 5’-Bereich gelegenes Stopkodon
nicht vorhan­den ist, ist die Startaminosäure schwer zu definieren (s.
Abb. 14). Der Sequenzvergleich mit anderen bekannten Fd
I-Transitsequenzen zeigt aber folgende gemeinsame Eigenschaften: (1)
97%ige Identität zur Transitsequenz von Tomate, (2) vergleichbare
Länge (46-54 Aminosäu­ren; s. Abb. 15), (3) Translationsstart mit
Met-Ala, wie für 88% der von Gavel & von Heijne (1990) untersuchten
chloroplastidären Präsequenzen nachgewiesen, (4) einen
charakteristisch hohen Gehalt der hydroxylierten Aminosäuren Serin und
Threonin (10-15 Reste in Fd I-Präse­quenzen, mit Ausnahme des Triticum
aestivum-Transitpeptids, das nur drei Serine ent­hält), (5) eine
positive Nettoladung und (6) mindestens ein Arginin-Rest in Position
–6 bis –10 von der angenommenen Spaltstelle entfernt, der
möglicherweise ein Erkennungssignal für die stromale
Prozessierungs-Protease darstellt (Gavel & von Heijne 1989). Für Fd I
aus Silene pratensis wurde nachgewiesen, daß diese Region für den
Import des Proteins in das Chloro­plastenstroma essentiell ist (Smeekens et al. 1987).
Für die Festlegung der Spaltstelle erfolgte ein
Aminosäuresequenzvergleich mit reifen Fd I-Pro­teinsequenzen anderer
Pflanzenarten, die nach biochemischer Reinigung über
Protein-Sequen­zierung analysiert wurden (s. Abb. 15). Dies zeigte,
daß das im Chloroplastenstroma vorhandene, funktionale Protein mit
einem Alanin-Rest beginnt. Demnach muß die Spaltstelle des in dieser
Arbeit isolierten Kartoffel-Klons zwischen Methionin 47 und Alanin 48
lokali­siert sein. Aber die Umgebung dieser angenommenen Spaltstelle
stimmt nicht mit dem locker konservierten Konsen­sus-Motiv
(Ile/Val)-X-(Ala/Cys/Ser)¯(Ala/Ser/Cys/Met) überein, das für die
Mehrheit der Chloroplasten-Präproteine nachgewiesen werden konnte (Gavel & von
Heijne 1990). Verschiebung der Spaltstelle um eine Aminosäure nach
links, wie auch schon von Gavel & von Heijne (1990) für die
abgeleitete Fd I-Aminosäuresequenz aus Silene pratensis vorgeschlagen,
ergibt dagegen eine perfekte Überein­stimmung der Fd I-Sequenz aus
Kartoffel mit dem Konsensusmotiv. Nach Abspaltung des Tran­sitpeptids
würde das initiale Methionin des reifen Fd I dann nachfolgend durch
eine stromale Methionyl-Aminopeptidase entfernt werden, da N-terminale
Methionine von Plastiden-kodierten Proteinen oft auf diese Art
prozessiert werden (Flinta et al. 1986, Michel et al. 1988, Ikeuchi
et al. 1989, Webber et al. 1989,).
Das reife Kartoffel-Fd I wies eine extrem hohe Identität zu Fd
I-Sequenzen aus anderen höhe­ren Pflanzen auf (74-95%, s. Tab. 4). Da
Ferredoxine eine multiple Genfamilie darstellen und in
photosynthetisch aktiven Blättern noch eine zweite Fd-Isoform, Fd II,
nachgewiesen werden konnte, war es wichtig zu klären, ob es sich bei
dem isolierten Kartoffel-Klon auch tatsächlich um Fd I handelt. Ein
Vergleich zwischen Fd I aus Kartoffel mit Fd II aus Tomate ergab die
sehr viel geringere, prozentuale Identität von 79% im Gegensatz zum
Vergleich der beiden entsprechenden Fd I-Sequenzen (95%). Die
Identität zwischen Fd I aus Kartoffel und Fd II aus Tomate entsprach
aber dem Wert, der bei einem Vergleich von Fd I mit Fd II aus Tomate
(80%) und bei Vergleich von Fd I mit Fd II aus Spinat (74%) bestimmt
wurde. Eine noch ge­ringere Identität wiesen Fd I und Fd III aus Mais
auf (64%). Diese Befunde untermauern die Schlußfolgerung, daß es sich
bei dem in dieser Arbeit beschriebenen Klon um Fd I handelt. Auch die
Ergebnisse der „Southern Blot“-Analyse weisen darauf hin, daß keines
der im Ge­nom vorhandenen anderen Ferredoxinsequenzen von dem
radioaktiv-markierten Fd I-Klon, der als Sonde benutzt wurde, erkannt
werden. Die Selektivität dieser Erkennung ist weiterhin ein guter
Hinweis auf die vermutlich entsprechend hochspezifische Bindung des
endogenen Fd I-Genproduktes und stellt somit eine optimale
Voraussetzung für die Konstruktion von trans­genen Fd I
„antisense“-Pflanzen dar.
4.2.2 Transgene Kartoffelpflanzen mit erhöhten bzw. erniedrigten
Gehal­ten an Ferre­doxin I
Für die Herstellung von Fd I über- bzw. unterexprimierenden
Kartoffelpflanzen erfolgte eine Subklonierung der
Ferredoxin-cDNA-Fragmente in „sense“- und „antisense“-Orientierung in
die Pflanzenexpressionskassette pA35S und nachfolgend in die
T-DNA-Region des binären Vektors pDE1001 (s. Abb. 5). Die transgenen
Pflanzen wurden durch A. tumefaciens-vermit­telte
Blattscheiben-Transformation hergestellt.
Im Fall der Unterexprimierer zeigte ein extrem hoher Anteil von 92%
aller im „Western Blot“-Verfahren getesteten Pflanzen eine deutliche
Reduktion im endogenen Fd-Gehalt. Für die Immun­detektion stand ein
polyklonaler anti-Fd I-Antikörper aus Spinat zur Verfügung, der aber
eine recht hohe Kreuzreaktion mit dem Kartoffelantigen aufwies. Im
Molekular­gewichts­bereich von Fd I wurde eine 18 kDa-Bande, manchmal
aber auch eine 22 kDa-Bande detek­tiert. Da die Signale auf dem
„Immunprint“, unabhängig von der applizierten Proteinmenge (100-200
µg), oft sehr schwach waren und das Protein in SDS-Gelen
offensichtlich schlecht fokussierbar ist, erwies sich eine exakte
densitometrische Bestimmung als schwierig. Eine Er­klärung wäre
einerseits eine reduzierte Antigenität zwischen dem Kartoffel-Fd I und
den Spinat­antikörpern. Diese Möglichkeit kann aber durch die
vergleichbare Signalstärke auf einem „Western Blot“ mit
Verdünnungsreihen von Proteinextrakten aus Spinat- und
Kartoffel­blättern ausgeschlossen wer­den. Andererseits kann aber auch
die schon beschriebene anormale Interaktion von Fd mit SDS, welche zu
unscharfen Banden im Gel führt, für dieses Phänomen verantwortlich
sein (Wedel et al. 1988, Green et al. 1991). Die 22 kDa-Bande deutet
auf eine Akkumulation von Fd I-Präprotein-Sequenzen im Cytosol hin, da
nach in vitro-Translation des Fd I-Klons und nachfol­gender „Western
Blot“-Analyse ebenfalls eine Bande mit diesem Mole­kulargewicht
detektiert werden konnte (s. Abb. 24).
Der niedrigste in 55 unabhängigen transgenen Linien detektierte Fd
I-Gehalt betrug ca. 50% der in Wildtyp-Pflanzen bestimmten Menge (s.
Abb. 16). Interessanterweise wiesen diese „anti­sense“-Pflanzen
bereits auffällige, sichtbare Veränderungen im Phänotyp auf. Wie schon
in Ge­webekultur beobachtet, hatten die Blätter der „antisense“-Linien
A7 und A99 bei An­zucht in Erde eine blaßgrüne bis gelbliche Farbe.
Vier der transgenen „antisense“-Linien, die während der
Kana­mycin-Selektion Wurzeln entwickelten, waren nicht in der Lage,
autotroph in Erde zu wach­sen. Zusätzlich wiesen die Unterexprimierer
ein deutlich verringertes Wachs­tum auf. Im Gegen­satz dazu war eine
große Anzahl der „sense“-Linien dunkler grün gefärbt und zeigte eine
höhere Wachstumsrate.
Die Unterschiede in der Wuchshöhe waren bei Verwendung gleich großer
und im Entwick­lungs­stadium vergleichbarer Knollen sehr gering (s.
Abb. 25A). Auch extreme Unterschiede in der Blattfärbung waren nach
Anzucht der ent­sprechenden Pflanzenlinien aus Knollen nicht mehr so
deutlich ausgeprägt (s. Abb. 25), aber wie die Bestimmung der
Chlorophyllgehalte verdeutlicht, weiterhin vorhanden (s. Abb. 26A).
Der Verlust an Chlorophyll scheint ein dyna­mischer, sich über den
Wachstumszeitraum verstärkender Prozeß zu sein, da die Grünfärbung der
Blätter der „antisense“-Pflanzen von den jüngsten (oberstes Blatt) bis
zu den ältesten (unterstes Blatt) sukzessiv abnahm. Im Verlauf der
Anzucht (bis zu zehn Wochen) war diese verminderte Grünfärbung immer
deutlicher ausgeprägt (s. Abb. 25C). Da dieser Effekt in
unter­schiedlich starker Ausprägung bei einer derart großen Anzahl von
unabhängigen trans­genen Linien auftrat, ist eine Abhängigkeit vom
Integrationsort der T-DNA in das pflanzliche Genom unwahrscheinlich.
Die chloroplastidäre Isoform Fd II scheint nicht in der Lage zu sein,
die Funktion von Fd I zu übernehmen. Für beide Ferredoxine wurden
vergleichbare Molekulargewichte, isoelektrische Punkte und
Redox­potentiale nachgewiesen. Unterschiede wurden aber in der
katalytischen Aktivität bestimmt. Fd I kann effektiver Elektronen auf
NADP übertragen als Fd II (Dutton et al. 1980). Zurückzuführen ist
diese Eigenschaft vermutlich auf einen Amino­säreaustausch in Fd II
(Asn 65 in Mais, Fd I: Asp), der eine schwächere Interaktion mit FNR
bewirkt (Kimata-Ariga et al. 2000). Dies deutet dar­auf hin, daß der
Elektronentransfer auf die verschiedenen Akzeptoren von Fd II nicht
effektiv übernommen werden kann.
In Kombination lassen diese ersten Beobachtungen die Schlußfolgerung
zu, daß 50% der im Wildtyp vorhandenen Menge an Fd I notwendig ist, um
ein Minimum an Funktionen, in die Fd I invol­viert ist, zu erfüllen
und wichtige Reaktionen, die mit pflanzlichem Wachstum ver­bunden
sind, aufrechtzuerhalten. Eine weitere Reduktion des Fd I-Gehaltes
scheint für die Pflanze letal zu sein. Der Vergleich dieses Befundes
mit Ergebnissen, die für einzelne, eben­falls im Chloro­plastenstroma
lokalisierte Enzyme erzielt wurden, verdeutlicht dann die Diskre­panz
in den not­wendigen absoluten Mengen der jeweiligen Enzyme. In
transgenen Kartoffel- bzw. Tabakpflanzen, die mit einem
„anti­sense“-Konstrukt der FBPase (Koßmann et al. 1992), der PRK (Paul et al. 1995),
der NAD(P)-GAPDH (Price et al. 1995B) oder der kleinen Unter­einheit
der RubisCO (Rodermel et al. 1988) transformiert wurden, lag die
stärkste stabile Re­duktion des jeweiligen Proteins zwischen 7% und
15% des Wildtyp-Niveaus. All diese En­zyme sind im Calvin-Zyklus
lokalisiert und katalysieren mit Ausnahme der NAD(P)-GAPDH
irreversible Reaktionen. Trotz der Wichtigkeit dieser Enzyme können
offensichtlich große Mengen an Enzym entfernt werden, ohne daß es für
die Pflanze letal ist. In diesen Pflanzen wurden zwar extreme
Änderungen im Phänotyp und den Metabolit-Gehal­ten beschrieben, aber
sowohl im Fall der PRK als auch der FBPase führte die stärkste
Reduktion nicht zu einer Inhi­bierung des Flusses durch diesen
Stoffwechselweg. Im Fall der NAD(P)-GAPDH wurde die CO2-Assimilation
nicht beeinträchtigt, bevor der Aktivität des Enzyms unter 30-40% der
Wildtyp-Aktivität sank (Price et al. 1995B).
Beim Vergleich der in den „antisense“-Pflanzen bestimmten mRNA-Gehalte
für Fd I mit den Proteingehalten fiel eine starke Diskrepanz auf: die
detektierte Transkriptmenge lag zwischen 5% und 10% der in
Wildtyp-Pflanzen bestimmten Menge, während im korrespondierenden
Protein­gehalt eine maximale Reduktion von 50-80% bestimmt wurde. Eine
ähnliche Relation zwischen Protein- und mRNA-Gehalten wurde auch für
transgene Tabakpflanzen mit redu­zierten Gehalten des
Rieske-FeS-Proteins beschrieben, das eine Untereinheit des in der
Thyla­koidmembran lokali­sierten Cyt bf-Komplexes ist (Price et al.
1995A). In diesen Pflanzen variierte der Gehalt des Rieske-Proteins
zwischen 14% und 40% des Wildtyps bei einer mRNA-Reduktion von mehr
als 90%. Die Autoren schlossen daraus, daß eine begrenzte Spanne
existiert, in der eine post-transla­tionale Anpassung möglich ist, und
daß erst, wenn der mRNA-Gehalt unter eine bestimmte Schwelle fällt,
eine Reduktion im Proteingehalt die Folge ist. Im Gegensatz zu den
Fd-Pflanzen war die Anzahl der Rieske-„antisense“-Pflanzen, die einen
veränderten Phänotyp aufwiesen, sehr gering. Price et al. (1995A)
führten dies darauf zurück, daß es in diesem Fall problematisch ist
den RNA-Gehalt der entsprechenden Zielpro­teine so weit zu reduzieren,
daß Pflanzen mit verändertem Phänotyp entstehen.
Für Fd sind zahlreiche Daten über Transkriptionskontrolle,
mRNA-Stabilität und den Protein­import in das Chloroplastenstroma
verfügbar. Während des Ergrünens junger Pflanzen unter­liegt die
Kontrolle der Transkription dem Phytochromsystem (Dobres et al. 1987,
Kaufman et al. 1985). Zusätzlich beinhaltet die Fd-Sequenz sowohl in
der 5¢-untranslatierten als auch in der 5¢-translatierten Region
„Licht-regulatorische“ Elemente, welche die Tanskrip­tion in der
grünen Pflanze beeinflussen und diese Funktion selbst unter Kontrolle
des konstitutiven CaMV35S-Promotors ausüben (Elliott et al. 1989,
Dickey et al. 1992, Bovy et al. 1995). Eine Blockierung der
Translation destabilisiert die mRNA im Licht (Dickey et al. 1994).
Petracek et al. (1997) beobachteten bei geringen Lichintensitäten oder
nach DCMU-Behandlung eine Hemmung der Bindung von fed 1-mRNA an
Polyribosomen, so daß die Translation vermutlich auch von
Photosyn­these-Prozessen beeinflußt wird. Eine wichtige Rolle für die
Translation scheint das „heat shock protein“ HSP101 zu spielen, da es
in vivo durch Bindung an die internen Licht-regulierten Elemente im
Transkript wohl die transla­tionale Regulation vermittelt und positiv
beeinflußt (Ling et al. 2000).
Neben diesen auf post-transkriptionaler Ebene und auch auf Ebene der
Translation greifenden Mechanismen scheint auch der Import von Fd I in
das Chloroplastenstroma sehr effizient zu sein. In diesem Zusammenhang
sind besonders die Ergebnisse von Smeekens et al. (1986) interessant.
Diese Autoren konnten direkt nachweisen, daß der in vitro-translatierte
Fd I-Klon aus Erbse vier­mal effektiver in das Chloroplastenstroma
importiert wird, als Plastocyanin, welches ebenfalls ein saures
Protein mit vergleichbarer Größe darstellt. Chimäre Proteine, wel­che
die Transitsequenz von Plastocyanin und das reife Fd I-Protein
enthielten, wurden in ver­gleichbarer Menge wie Fd I importiert, und
auch die Importmenge eines Fusionsproteins, das aus der Fd
I-Transitse­quenz und dem reifen Plastocyanin-Protein bestand, war
vergleichbar, aber die absolut importier­ten Mengen der Fd
I-Plastocyanin-Variante waren geringer. Diese Ergebnisse deuten
daraufhin, daß neben der Präsequenz die Struktur des reifen noch
ungefal­teten Proteins fast noch wichtiger für die Effektivität ist,
mit welcher ein Protein importiert wird. Dies scheint mehr oder
weniger unabhängig von der Größe und den weiteren chemischen
Eigenschaften, wie z.B. Azidi­tät, zu sein. Neuere Ergebnisse aus
„cross-linking“-Studien weisen auf eine besondere Bedeu­tung der
ersten 25 Aminosäuren im Transitpeptid von Fd I für den Import hin (Rensink et al. 2000).
Der post-translationale Transport schließt einen Protein-Komplex in
der äußeren und der inneren Chloroplastenhüllmembran und weitere
lösliche Pro­teine im Intermembranraum der Hüllmembran und im Stroma
ein (Schleiff & Soll 2000).
So scheint in den „antisense“-Fd I-Pflanzen der Rest der verbliebenen
noch freien Fd I-mRNA mit hoher Spezifität und auch Effektivität
translatiert und/oder an die diskutierten Transloka­toren ge­bunden
und über die Membran transportiert zu werden. Dies resultiert in der
beobach­teten maxi­malen Reduktion von 50% des Proteingehaltes
gegenüber dem Fd I-Wildtyp. Damit wird weiter­hin impliziert, daß beim
Absinken des RNA-Gehaltes unter den beobachteten Minimalwert von 5%,
entweder eine effektive Translation und/oder eine effektive
Transloka­tion nicht erfolgen kann.
In allen Fd I-transformierten Kartoffelpflanzen, nicht aber in den
Wildtyp-Pflanzen, wurde neben dem mit einer Länge von 760 bp korrekt
vorliegenden fed 1-Transkript auch eine Bande auf der Höhe von 1000 bp
detektiert (s. Abb. 17B). Der Grund dafür könnte in einer vermehr­ten
Expression einer anderen Isoform liegen. Auf diese Weise wäre dann das
Expressions­muster der verschiedenen Isoformen verändert. Eine andere
Möglichkeit ist, daß diese zusätz­lichen Ban­den allein auf das
eingebrachte Konstrukt zurückzuführen sind. Hase et al. (1991)
isolierten aus einer cDNA-Expressions-Bibliothek, kon­struiert aus
sechs Stun­den belichteten etiolierten Mais-Keimlingen, auch einen
genomischen Klon für ein nicht-photo­synthetisches Ferredoxin. Dieses
Gen kodiert für das Fd III-Präprotein, welches über die ganze Pflanze
ver­teilt ist, aber vorwiegend in Wurzeln exprimiert wird.
Identifiziert wurde Fd III auf Protein­ebene in jungen Blättern, im
Mesokotyl und in Wurzeln von etiolier­ten Mais-Keimlingen, wobei auch
nach dreitägiger Belichtung der Gehalt konstant blieb (Kimata & Hase
1989). Fd III wurde auch aus Wurzeln von Tomate (Green et al. 1991)
und Rettich (Wada et al. 1989) gerei­nigt und eine partielle
Aminosäuresequenz konnte bestimmt wer­den. Die Länge des fed 3-Transkripts
liegt zwischen 900-1000 bp und kann auf „Northern Blots“ von
mRNA-Proben aus Blatt, Mesokotyl und Wurzel nur mit dem 32P-markierten
fed 3-Klon detektiert werden, während keine Kreuzreaktion mit dem 32P-markierten
fed 1-Klon aus Mais gefunden wurde. Matsumara et al. (1997)
identifizierten ein weiteres, Nitrat-induzierbares Ferredoxin (Fd IV)
in Mais-Wur­zeln, welches nach Behandlung mit Nitrat auch in Blättern
exprimiert wird. Die Menge an fed 4-Transkript, mit einer Länge von
etwa 1000 bp, steigt inner­halb von zwei Stunden nach Nitrat-Zu­gabe
stark an. Unter diesen Bedingungen war keine Änderung in der
Expression des fed 3-Gens zu verzeichnen. Das in der Größe sowohl mit
fed 3 als auch mit fed 4 vergleichbare 1000 bp-Signal, welches auf
Kartoffelblatt-RNA-Blots sämtli­cher Fd I-Transformanten markiert
wurde, zeigte parallel zum Expressionsniveau des fed 1-Gens
Schwankungen in der absolut detektierten Menge. Da in anderen Pflanzen
auf RNA-Ebene keine Kreuzreaktion mit den für die verschiede­nen
Fd-Isoformen kodierenden mRNAs stattfindet und selbst die fed 1-mRNA
aus Spinat und Kartoffel untereinander nicht erkennen (s. Abb. 17A),
ist das in dieser Arbeit markierte Transkript somit nicht auf interne
Änderungen des Fd-Expressionsmusters in den Transformanten
zurückzu­führen. Dafür, daß diese Doppel­banden durch die
eingebrachten Konstrukte hervorgerufen wer­den, spricht der Befund,
daß auch in den mit dem heterologen Spinat-cDNA-Fragment
transfor­mierten „sense“-Transfor­manten dieses Phänomen auftritt. Da
die Pflanzen mit einem cDNA-Konstrukt transformiert wurden, ist es
auch unwahrscheinlich, daß eine nukleäre, nicht-prozessierte RNA-Form
akku­muliert.
Auch in Knollen (s. Abb. 19) und Wurzeln (Daten nicht gezeigt) der
transgenen Kartoffel­pflanzen hatte die Transformation mit dem Fd
I-„sense“- bzw. -„antisense“-Konstrukt auf Proteinebene keinen Einfluß
auf die Fd I-Expression. Auf mRNA-Ebene hingegen wurden einige
Unterschiede detektiert. So war in den Knollen der Unterexprimie­rer,
ähnlich wie im Fall der mRNA aus grünen Blättern, ein 1000 bp
Transkript markiert, das, wie oben diskutiert, wohl ebenfalls auf das
transformierte Kartoffelgen zurückzuführen ist. Gestützt wird dies
durch die Tatsache, daß in Knollen der Kontrollpflanzen weder mit der
Spinat- noch mit der Kartoffel-Sonde ein Transkript dieser Größe
markiert wurde. Interessanterweise wurde in den Knollen der Unter- und
Überexprimierer und den Kontrollpflanzen mit 32P-markierter fed 1 cDNA
aus Kartoffel ein Transkript markiert, das in der Größe etwas unter
dem des „normalen“ fed 1 lag und in den „antisense“-Pflanzen ein
schwächeres Signal im Vergleich zu den Kon­trollen aufwies (s. Abb.
20). Dies deutet auf eine dem Kartoffelblatt-fed 1 sehr ähnliche
Enzym-Form hin, die eventuell durch die „antisense“-Transformation in
der Expressionshöhe beeinflußt wurde. Um eine Kreuzreaktion mit dem in
„sense“-Orientierung inserierten Spinat-Klon kann es sich nicht
handeln, da dieser ausschließlich mit der Spinat-cDNA-Sonde
detek­tiert werden kann (s. Abb. 20 oben). Um zu klären, ob es sich
tatsächlich um eine Isoform oder um das auch schon in Knol­len
exprimierte fed 1 aus Blättern handelt, müßte in weiterführen­den
Experimenten geklärt wer­den. Für eine neue Form sprechen die stark
verringerten Signal­stärken auf mRNA-Ebene und die ebenfalls extrem
schwachen Signale auf den „Western Blots“, die in dieser Form nur in
Knollen-Proteinextrakten gefunden wurden. Die geringere Signalstärke
in den Knollenextrakten wäre dann durch eine schwächere Kreuzreaktion
zwischen dem Fd I-Antikörper aus Spinat und dem Kartof­fel-Fd-Antigen
in Knolle erklärbar.
Demgegenüber ist das Vorkommen des etwa 900 bp langen Transkripts in
den Wurzeln der unter­exprimierenden Kartoffelpflanzen auf einen
anderen Mechanismus zurückzuführen. Die Transkription des gegen die
Leserichtung zwischen den konstitutiven CaMV35S-Promotor und die
pNOS-Terminationssequenzen inserierten Kartoffel cDNA-Fragments
resultiert in einem komplementären mRNA-Strang, der keine Information
für ein funktionales Protein trägt. Wenn dieses „antisense“-Konstrukt
in Geweben exprimiert wird, in denen keine Ziel-mRNA von
ausrei­chender Homologie vorhan­den ist, bleibt die Bildung von
„sense:antisense“-Hybri­den aus. Da in den Wurzeln der
Wildtyp-Pflanzen kein Transkript und in Wurzelextrakten von
„antisense“-Kartoffelpflanzen ein starkes Signal gefunden wurde, liegt
die Schlußfolgerung nahe, daß die ein­zelsträngige „antisense“ fed 1-mRNA
akkumuliert. Diese mRNA scheint in Bezug auf
Synthese-/Degradierungsgleichgewichte eine stabilere Form darzustellen
als die­jenige, die in Blättern dieser Unterexprimierer detektiert
wurde.
Eine Ausnahme unter allen in dieser Arbeit untersuchten Fd
I-„antisense“-Pflanzen stellt die Linie A99 dar. Bei dieser Linie
wurde ein sehr schwaches mRNA-Signal in Blättern (s. Abb. 17), ein
Signal in Knollen (s. Abb. 20), aber im Gegensatz zu den anderen
„anti­sense“-Pflanzen kein Signal in Wurzeln detektiert (s. Abb. 19).
Dies könnte durch einen Mechanismus hervorgerufen werden, der als
post-transkriptionales „gene silencing“ bezeichnet wird, welches bei
verschiedenen transgenen Pflanzen beobachtet wurde (Waterhouse
et al. 1998, Faske et al. 1998). Voraussetzung ist das parallele
Vorkommen von „sense“- und „antisense“-RNA des Zielgens. Durch die
Integration des Fd I-„antisense“-Gens in eine Region des
Pflanzengenoms, in der das 3’-Ende eine große räumli­che Nähe zu einem
starken endogenen Promotor aufweist, kann dann „sense“-RNA gebildet
wer­den, die mit der „antisense“-RNA hybridisiert. In dem Modell von
Waterhouse et al. (1998) wird der RNA-Duplex nachfolgend von einem
Komplex erkannt, der aus einer Pflanzen-kodierten
Doppel­strang-RNA-abhängigen RNA-Polymerase, einer Helikase und RNase
L-ähnlichen Endo­nukleasen zusammengesetzt ist. Der Komplex
transkribiert cRNA, verknüpft die Enden mit den RNase L-ähnlichen
Molekülen und setzt diese cRNA frei. Die cRNA-RNase-Moleküle binden
die endogene und/oder die durch das eingebrachte Konstrukt produzierte
RNA und schneiden die überhängenden einzelsträngigen Regionen nahe des
Hybrids. Die verbleibende RNA-Duplex ist resistent gegen unspezifische
Degradierung und dient als Vorlage für die Synthese neuer
cRNA-RNase-Moleküle. Ist dieser Zyklus erst initiiert, wird keine
weitere kernkodierte doppelsträngige RNA benötigt. Über diesen
Mechanismus ist dann eine vollstän­dige Bindung sämtlicher
RNA-Moleküle denkbar. Um dieses für die Fd I-„antisense“-Linie A99 zu
manifestieren, müsste ein Nachweis beider RNA-Formen z.B. über
strangspezifische Sonden erfolgen. Weiterhin kann postuliert werden,
daß der bei der Linie A99 beobachtete Effekt durch einen
gewebespezifischen Promotor hervorgerufen wird, der nur in Wurzeln
aktiv ist.
4.2.3 Effekt von veränderten endogenen Fd I-Gehalten auf die
Photosynthese und Elektronenverteilung
Die Änderungen in den endogenen Fd I-Gehalten der transgenen
Kartoffelpflanzen wirkten sich sowohl auf den photosynthetischen
Elektronentransport als auch auf die Elektronenver­teilung im
Chloroplastenstroma aus. Die in Kurzzeitmessungen (bis zu 8 min nach
Belich­tungsbeginn) be­stimmten CO2-Assimilationsraten lagen im Fall
der „sense“-Transformanten schon nach viermi­nütiger Belichtung über
dem Wildtyp-Niveau (s. Abb. 31A). Nach Erreichen der „steady
state“-Photosynthese waren die Assimilationsraten ab
Licht­intensitäten von 850 µE um 15% gegenüber den Wildtyp-Pflanzen
erhöht (s. Abb. 30A). Sämtliche Kompo­nenten der
Elektronentransportkette waren oxidierter (s. Abb. 30B), während keine
Änderung in den Elektronenflüssen über die beiden Photosysteme im
Vergleich zu den Wildtyp-Pflanzen de­tektiert wurde (s. Abb. 30D und
30E). Im Gegensatz dazu war die in den „antisense“-Pflanzen gemessene
Assimilationsrate in Abhängigkeit vom bestimmten Fd I-Gehalt im
Vergleich zu Wildtyp-Pflanzen bis über 50% reduziert (z.B.
Transformante A99, s. Abb. 30A und Abb. 31A). Auch der Elektronendruck
der Elektronentransportketten war stark erhöht (s. Abb. 30B und 31B).
Dies wird durch die erniedrigten qP-Werte verdeutlicht, die auf ein
stärker redu­ziertes QA in PS II hinweisen und auch nachfolgend einen
erhöhten Redox-Zustand von PQ anzeigen. Die Quantenausbeuten als Maß
für den Elektro­nenfluß durch das jeweilige Photo­system waren in
beiden Photosystemen ebenfalls sehr gering. Die erniedrigten fI-Werte
deuten auf eine Akkumulation von P700 in der oxidierten Form (P700+)
hin (s. Abb. 30E). Parallel nahmen die fII-Werte in noch stärkerem
Maße ab (s. Abb. 30D), so daß in den ersten Minu­ten ein bis zu
3,5fach erhöhtes fI/fII-Verhältnis in den transgenen Linien mit den am
stärksten redu­zierten Fd I-Gehalten meßbar war (s. Abb. 31D). Diese
reduzierten Elektronenflüsse können eine extrem verminderte
Bereitstellung von Elektronen für sämtliche Elektronen-ab­hängigen
Prozesse im Chloroplastenstroma bedeuten.
Parallel dazu wurden Veränderungen in den nicht-assimilatorischen
Elektronenflüssen sicht­bar. Der Aktivierungszustand der NADP-MDH, die
den Fluß an „Überschußelektronen“ auf OAA kontrolliert (Fridlyand et al. 1998),
war nur in den Pflanzen mit den niedrigsten Fd I-Gehalten (z.B. A99)
während der photosynthetischen Induktionsphase extrem erhöht, fiel
dann aber auf Kontrollniveau ab (s. Abb. 31C). Der erhöhte
Aktivierungszustand in den ersten Minu­ten nach Beginn der Belichtung
spiegelt den im Vergleich zu den Wildtyp-Pflanzen erhöhten Gehalt an
NADPH im Stroma wieder, da durch das verzögerte Einsetzen der CO2-Fixierung
in den „antisense“-Pflanzen (s. Abb. 31A) ein verminderter Verbrauch
an NADPH durch die NAD(P)-GAPDH besteht. In den Fd
I-„antisense“-Pflanzen benötigt offensichtlich die Aktivierung der
Enzyme des Calvin-Zyklus und auch der Aufbau der verschiedenen
Meta­bolitspiegel einen län­geren Zeitraum als in den
Wildtyp-Pflanzen. Hervorgerufen werden könnte dies durch einen
kombinierten Mechanismus. Einerseits liegen klare Evidenzien vor, daß
zu wenig Elektronen im Stroma ankommen und somit die Aktivierung der
redoxmodu­lierten Enzyme beeinträchtigt ist. Diese Sachverhalte wären
im Weiteren zu überprüfen.
In den „antisense“-Pflanzen wurde unter „steady state“-Photosynthese
ein 1,5fach erhöhter Elektronenfluß durch PS I als durch PS II
gemessen, so daß offensichtlich der zyklische Elektro­nentransport
einen erheblichen Anteil des Elektronentransportes ausmacht. In
Wildtyp-Pflanzen liegen für diesen Elektronenfluß kaum Evidenzien vor,
wie an den fI/fII-Verhältnis­sen von 1 nach Einstellung des „steady
state“ deutlich wird (s. Abb. 30D und 30E). Sichtbar wird der
zyklische Elektronentransport in intakten Wildtyp-Blättern sonst nur
unter extremen Bedingungen, wie z.B. bei Absenkung des O2- oder CO2-Gehaltes
im Meßgas (Harbinson & Foyer 1991, Backhausen et al. 1998). Dann
können die in den photosynthe­tischen Pri­märreaktionen erzeugten
Elektronen nicht durch die nachgeschalteten Reaktionen im Stroma
ver­braucht werden.
Eine weitere Möglichkeit für den Verbrauch der Elektronen ist die
Übertragung auf O2, der in intakten Blättern hauptsächlich unter hohen
Lichtintensitäten, d.h. bei einem sehr hohen Re­doxstatus der
Elektronentransportkomponenten, meßbar ist und dann bis zu 50% des
gesamten Elektronenflusses ausmachen kann (Osmond & Grace 1995). In
den Wildtyp-Kartoffelpflan­zen und auch interessanterweise in allen
„antisense“-Pflanzen war dieser Elektonenfluß nicht meßbar (s. Abb.
31E1-E3). Obwohl der Elektronendruck in den in Abbildung 31E1-E3
darge­stellten Mes­sungen, die während der photosynthetischen
Induktion durchgeführt wurden, extrem hoch war, trat keine Aufnahme
von O2 auf, welche nicht der Photorespiration zuzu­schreiben war.
Diese beobachteten Raten der Elektronenflüsse, insbesondere. die
geringen Raten der CO2-Assi­milation, der geringe Aktivierungszustand
der NADP-MDH und der hohe Anteil an zykli­schem Elektronentransport in
den „antisense“-Pflanzen, stimmen im wesentlichen mit der an
isolierten Chloroplasten aus Spinat beschriebenen hierarchischen
Anordnung der Elektronen­akzeptoren überein (Backhausen et al. 2000).
Von diesen Elektronen-abhängigen Reaktionen benötigen die CO2-Assimilation
und auch die Reduktion von Malat zu OAA durch die NADP-MDH den durch
die Primärreaktionen zur Verfügung gestellten löslichen
Elektronendonor NADPH. Die Reduktion von NADP wiederum ist von
reduziertem Fd abhängig, dessen Gehalt durch die
„antisense“-Transformation stark verringert ist. Als weitere Folge ist
dann auch der Elektro­nenfluß auf NADP reduziert, was u.a. durch die
verringerte CO2-Assimilation unter­mauert wird. So wird die CO2-Fixierung
noch im maximal möglichen Umfang aufrechterhal­ten, während der Fluß
über das Malat-Ventil unterbunden ist, da im Stroma keine
„Überschuß­elektronen“ vorhanden sind.
Im Fall der Fd I-„antisense“-Pflanzen wäre die Abweichung von der
Hierarchie in Spinatchlo­roplasten so zu erklären: Eine Abnahme des
„normalen“ Fd I/PS I-Verhältnisses von ca. 2,5 (Terashima & Inoue
1985), wie es in den „antisense“-Pflanzen durch den reduzier­ten
Gehalt an Fd I der Fall ist, oder ein Absinken des Fd I/PS
I-Verhältnisses unter einen be­stimmten Wert bewirkt zuerst, daß der
Elektronenfluß auf die löslichen stromalen Elektronenak­zeptoren
verringert wird (s. Abb. 42, Übergang von Weg 1 zu Weg 2). Dadurch
würde die Rate der NADPH-Bildung und vermutlich auch der
Elektronenfluß auf die Thioredoxine vermindert wer­den. Dies führt
dann zu der beobachteten verminderten CO2-Fixierung, dem unveränderten
Akti­vierungszustand der NADP-MDH und dem vermehrten Fluß über den
zyklischen Elektro­nen­transport (s. Abb. 42, Weg 2), der kein NADPH
als Elektronendonor benötigt. In den „anti­sense“-Pflanzen mit einer
etwa 50%igen Reduktion an Fd I scheint das PS I noch mit Fd ge­sättigt
zu sein, aber diese Menge ist wohl nur ausreichend, um Akzeptoren mit
Elektronen zu versorgen, die eine große räumliche Nähe zum PS I
aufweisen. Über die exakten Reaktionsab­läufe, die in den zyklischen
Elektronentransport involviert sind, der aber in den „antisense“ Fd
I-Kartoffelpflanzen offensichtlich einen hohen Anteil des insgesamt
gemessenen Elektro­nenflusses ausmacht, besteht nach wie vor
Unklarheit. Es gibt viele Hinweise, daß ausschließ­lich
membrangebundene Elektronenakzeptoren an diesem Prozess beteiligt sind
(Cleland & Bendall 1992, Bendall & Manasse 1995, Heimann & Schreiber
1999).

Abbildung 42: Modell zum Elektronenfluß um PS I in transgenen Fd
I-„antisense“-Kartoffelpflanzen.
1: Bei einer Balance zwischen Elektronenbereitstellung durch den
photosynthetischen Elektronentransport und Elektronenverbrauch im
Stroma wird der lineare Weg beschritten. Vorrausetzung ist, daß
genügend Akzeptoren im Stroma zur Verfügung stehen. 2: Ist der
Elektronenübergang von PS I auf Fd blockiert, da ein zu großer An­teil
der verbliebenen Fd I-Menge reduziert vorliegt, scheinen zunächst
Reaktionen wie der zyklische Elektro­nentransport abzulaufen, die in
großer räumlicher Nähe zu PS I liegen. 3: Bei größerer
Akzeptorlimitierung, d.h. mit abnehmender Fd I-Menge, kommt es
vermutlich zum „Elektronenstau“ an der Akzeptorseite von PS I.
Sämtliche dem P700 nachgeschaltete Akzeptoren liegen dann reduziert
vor und es kann keine stabile Ladungs­trennung erfolgen. Die Folge
könnten dann verminderte Fernrot-Signale sein.
Unter Berücksichtigung des Akzeptormangels des PS I wäre dann auf den
ersten Blick die Vorrausetzung für eine Übertragung der Elektronen auf
molekularen Sauerstoff gegeben, der al­lerdings in diesen Pflanzen
nicht meßbar war (s. Abb. 31E1-E3). Dieser Prozeß scheint in hohen
Raten hauptsächlich von einer Form des PS I katalysiert zu werden, an
das kein Fd ge­bunden ist (Asada & Nakano 1978; Furbank & Badger
1983). Da eine Reduktion des zel­lulären Fd-Ge­haltes unter 50%
offensichtlich in Letal-Mutanten resultiert, ist es durchaus denkbar,
daß in diesen Pflanzen eine erhöhte Bildung von O2-Radikalen auftritt.
Diese Radi­kale könnten dann durch freies PS I gebildet werden,
welches kein Fd gebunden hat. Eine Ak­kumulation dieser Radikale führt
im Endeffekt zur Schä­digung von verschiedenen intrazellulä­ren
Strukturen und nachfolgend zum Absterben der Blätter und ganzen
Pflanzen. Unterstützt wird dies durch die schon in Gewebekultur
beobachtete extrem grün-gelbliche Blattfarbe der Pflanzen, die auf
einen stark reduzierten Chlorophyllgehalt und/oder geschädigte
Chloro­phyllmoleküle hinweist.
Wie aus den verschiedenen gemessenen Photosynthese-Parametern deutlich
wird, beruht der Schutzmechanismus der „antisense“-Pflanzen gegen den
Elektronenüberschuß hauptsächlich auf der Verminderung der
Lichtabsorption und der verringerten Effizienz der Lichtnutzung,
anstatt O2 als alternativen Akzeptor zu nutzen. Dabei scheinen von den
moderat supprimierten „antisense“-Linien A100, A93 und A62 andere
Strategien genutzt zu werden als von den stärker supprimierten Linien
A99 und A150. In den Linien mit Fd I-Gehalten zwischen 70-90% des
Wildtyp-Niveau war das FO/FM-Verhältnis im Vergleich zu den Kontrollen
eher er­höht und es war ein sehr hoher qNP-Wert meßbar (s. Abb. 30C).
Dies deutet auf einen erhöh­ten transmembranen pH-Gradienten hin, der
vermutlich durch den verstärkten zyklischen Elektronentransport
hervorgerufen wird (s. Abb. 42, Weg 2), und auf diese Weise eine
Herunter­regulierung der PS II-Aktivität zur Folge hat. Dies wird
durch die Tatsache gestützt, daß der in diesen Pflanzen gemessene fII-Wert
im Ver­gleich zu den Kontrollpflanzen sehr gering war, und diese
Pflanzen so einen geringeren Anteil der eingestrahlten Lichtmenge für
den Elektronentransport nutzen (s. Abb. 30D). Für eine Sensor- bzw.
Signal-Funktion eines hohen pH-Gradienten bei einem Überschuß an
eingestrahlten Photo­nen sprechen viele Daten in der Literatur. Eine
starke Ansäuerung des Thylakoidlumens tritt auf, wenn der
ATP-Verbrauch durch CO2-Limitierung oder durch eine Streß-induzierte
Dysfunktion der Enzyme im Calvin-Zyklus begrenzt wird (Demmig-Adams & Adams
1992, Horton et al. 1996). Der niedrige pH-Wert bewirkt zum einen über
die Aktivierung einer Violaxanthin-De-Epoxidase, welche im LHC II
gebundenes Violaxanthin zu Zeaxanthin umsetzt, eine photopro­tektive
Energiever­teilung. Auch über Protonierung von LHC II-Untereinheiten
induzierte Kon­formationsände­rungen in den LHC II tragen zu diesem
Schutzmechanismus bei (Ort 2001).
Die verringerte Lichtnutzung kann auch durch eine reversible,
licht-abhängige Phosphorylie­rung der LHC II über eine
LHC II-Protein-Kinase hervorgerufen werden (Rintamäki et al. 1997,
2000, Carlberg et al. 1999, Zer et al. 1999). Allgemein akzeptiert
ist, daß eine Phosphorylierung der mobilen LHC-Untereinheiten die
Dissoziation des Kom­plexes vom PS II bewirkt. Durch die so­genannten
„state transitions“ (Übergang von „state 1“ zu „state 2“) wird dann
die Übertragung von Anregungsenergie von den Lichtsammelkom­plexen auf
das Reaktionszentrum von PS II re­duziert. Die Aktivierung und die
letztendlich resultierende Aktivität der LHC II-Kinase erfolgt
vermutlich durch drei verschiedene, regulato­risch wirkende Zustände
des Enzyms (Rintamäki et al. 2000). In dunkel-adaptierten Blättern
liegt die Kinase inaktiv vor und wird im Licht mittels Reduktion von
PQ und des Cyt b/f-Komplexes aktiviert. Die Aktivierung geht mit einer
Konfor­mationsänderung einher, durch welche eine regulatorische
Disulfidbrücke im Protein verborgen wird (Vener et al. 1998, Rintamäki et al. 2000).
Dieser Zustand, der eine maximale Phosphory­lierung von LHC II
bewirkt, wurde von Rintamäki et al. (1997, 2000) für mit Schwachlicht
(30 µE) bestrahlte Blattscheiben beschrieben. Belichtung mit höheren
Lichtintensitäten (1000 µE) hingegen führte dann zu einer Abnahme der
Phosphorylierung, die der Inaktivierung des Enzyms durch Reduktion der
regulatorischen Disulfidbrücke mittels Thioredoxin zugeschrieben
wurde. Somit scheint die Phosphorylierung des N-Terminus der
LHC II-Proteine sowohl über den Re­doxstatus von PQ und des Cyt bf-Komplexes
als auch über den Reduktionsgrad im Stroma regu­liert zu werden. Die
Bedeutung der LHC II-Phosphorylierung, welche nach klassischer
Auffas­sung durch das Abdiffundieren der LHC II vom PS II die
Anregungsenergie zwischen den Photo­systemen balanciert, ist für die
Pflanze im Schwachlicht nicht geklärt (Rintamäki et al. 2000). Gerade
unter diesen Bedingungen sollte ein möglichst effizienter
Elektronentransport auf die stromalen Akzeptoren gewährleistet werden,
so daß diese tran­siente Phosphorylierung eine wei­tere regulatorische
Funktion für die physiologische Relevanz in vivo impliziert.
Unterstützt wird dies durch den Befund, daß das
Phosphorylierungs­maximum weit unterhalb der Anzuchtintensität von
200 µE liegt (Rintamäki et al. 1997). Da verschiedene Kinasen
beschrieben wurden, die in die redox-abhängige Phosphorylierung
in­volviert sein könnten, besteht ebenso die Möglichkeit der
LHC II-Regulation über eine mul­tiple Phosphorylierung (Gal et al. 1997).
Viele Hinweise liegen auch für eine Konformation­sänderung von LHC II
nach Phosphorylierung vor (Allen 1992, Allen & Nilsson 1997). Aufgrund
der Ergebnisse von Zer et al. (1999) kann diese auch auf einer
Licht-induzierten Konformationsänderung von LHC II beruhen, die dann
erst eine Phosphorylierung ermöglicht. Da der N-terminale Teil des
Proteins essentiell für eine Trimerisie­rung von LHC II ist (Hobe et al. 1995),
welche die überwiegende mit PS II assoziierte Form von LHC II
darstellt (Jansson 1994), ist auch ein struktureller Effekt auf den
Trimerisierungsprozess denkbar (Gal et al. 1997). Übertragen auf die
Fd I-„antisense“-Pflanzen, könnte der stark erhöhte Re­duktionsgrad
von PQ bei gleichzeitig erniedrigtem Thiol-Redoxzustand im Stroma zu
einer im zeitlichen Verlauf verlängerten Aktivierung der LHC II-Kinase
führen. Folglich ist eine ver­stärkte Phosphorylierung von LHC II
denkbar, welche die Nutzung und Verteilung der Anre­gungsenergie
verändert. Auch eine Änderung in der Aggregation von LHC
II-Untereinheiten könnte in diesen Pflanzen vorhanden sein. Es liegen
aber auch Hinweise vor, daß die Phospho­rylierung Auswir­kungen auf
den Abbau von LHC II hat und der erhöhte Reduktionsgrad von PQ ein
Signal für die Expression der kernkodierten cab-Gene darstellt
(Diskussion dazu vgl. Kap. 4.2.4). Die mehr oder weniger unveränderten
FO/FM-Verhältnisse weisen auf jeden Fall in die Richtung, daß eine
Schä­digung und/oder verringerte Expression der PS II-Kompo­nenten in
diesen Pflanzen noch nicht vorliegt (s. Abb. 28B).
Anders scheint die Situation am PS I zu sein. Auch die moderat
reduzierten „antisense“-Linien wiesen ein reduziertes Fernrotsignal
auf (s. Abb. 28A), welches auf eine nicht-stabile Ladungs­trennung
beim Übergang von der reduzierten (P700) in die oxidierte (P700+) Form
hindeutet. Ur­sächlich können dafür verschiedene Gründe angeführt
werden, über die mit den hier erhobe­nen Daten aber nur spekuliert
werden kann. Eine Möglichkeit wäre eine Schädigung und/oder eine
veränderte Expression einer der Komponenten oder aber auch mehrerer PS
I-Komponen­ten, die in den Elektronentransfer involviert sind. Denkbar
ist durchaus auch, daß durch die verminderte Menge an Fd I im Stroma
ein Großteil des verbliebenen Fd an der Bindungsstelle am PS I
gebun­den bleibt und es so zu einem „Elektronenstau“ kommt (s. Abb.
42, Weg 3). Da sämtliche auf P700 folgende Akzeptoren reduziert
vorliegen, kann dann das Elektron von P700 nicht abgegeben werden und
folglich entsteht bei Anregung von PS I nur das verminderte DA830-Signal.
Daß im Stroma der Fd I-„antisense“-Pflanzen nur sehr wenig Elektronen
ankommen, kann aus den in allen „antisense“-Pflanzen gefundenen, stark
reduzierten Chlorophyllfluoreszenz-„End­signalen“ abgeleitet werden
(s. Abb. 29). Grundsätzlich handelt es sich bei der
Dunkel-Fluo­reszenz-Relaxation wohl um einen Prozeß, der ein Maß für
den „Elektronenrückfluß“ aus dem Stroma in die
Elektronentransport­kette beim Licht/Dunkel-Übergang ist. Den
Vorstellungen nach werden die Elektronen über den Cyt bf-Komplex
wieder in die Elektronentransportkette eingespeist. Dabei bestehen
zwei Mög­lichkeiten der Elektronenübertragung: 1. durch den
Fd-NADP-Dehydrogenase-Komplex (Kubicki et al. 1996, Feild et al. 1998)
oder 2. über den Anti­mycin-sensitiven zyklischen Elektronentrans­port
(Asada et al. 1992). Für den Elektronen­transfer wurden
Elektronenüberträger vorgeschlagen, wie z.B. peripheres Fd, NADPH oder
andere Elektronenüberträger, die in der Nähe der Thyla­koidmembranen
oder auch im Stroma lokalisiert sind (Asada et al. 1992).
Dementsprechend weist eine Abnahme im Endsignal, wie bei den Fd
I-„antisense“-Linien beobachtet, auf einen ver­ringerten
Reduktionsgrad verschiede­ner Elektronenüberträger im Stroma hin. Zu
beachten ist, daß ein Teil dieser Fluoreszenz auch durch die
Relaxation des PS II, bewirkt durch die Abnahme des
Protonengradienten, hervorge­rufen werden kann (P. Horton, University
of Sheffield, persönliche Mitteilung).
Im Gegensatz zu den moderat gedrosselten Linien wiesen die Linien A99
und A150 einen un­ver­änderten qNP (s. Abb. 30C) und ein reduziertes FO/FM-Verhältnis
auf (s. Abb. 28B). Das verrin­gerte FO/FM-Verhältnis ist ein Hinweis,
daß in diesen „antisense“-Linien Photoinhibition auftritt (vgl. dazu
Kap. 4.2.4). Letztlich führt diese Strategie aber zum gleichen
Resultat wie in den anderen nicht so stark supprimierten
„antisense“-Pflanzen, nämlich zu weniger funktiona­lem PS II,
verringerten Quantenausbeuten und einer verminderten Effizienz der
Lichtnutzung. Pflanzen, denen keine aus­reichende Menge an Fd I als
Elektronenakzeptor an der Akzeptor­seite des PS I zur Verfügung steht,
scheinen diese Strategien als Schutzmechanismus gegen eine übermäßige
Bildung von O2-Radikalen zu nutzen. Dies erscheint auch in der
Hinsicht als sinnvoll, da auch die Entgiftung die­ser für die Pflanze
äußerst toxischen Intermediate wie­derum reduziertes Fd benötigt.
Durch die verringerte Expression ist für den Umsatz dieser
Verbindungen in den „antisense“-Pflanzen kaum Fd vorhanden, so daß als
Folge der Akku­mulation von Radikalen und/oder H2O2 extreme
Schädi­gungen auftreten könnten.
Unter der Berücksichtigung der Tatsache, daß es sich bei den
Veränderungen in den „anti­sense“-Pflanzen, wie an dem über den
Wachstumszeitraum immer größeren Chlorophyllverlust sichtbar wird, um
einen dynamischen Prozeß handelt, ist auch denkbar, daß bei einer
verlän­gerten Wach­tumsperiode ähnliche Ergebnisse wie für die stark
supprimierten „antisense“-Pflanzen erzielt werden kön­nen. So wären
die moderateren Linien in einem „Entwicklungs­zustand“, den die
stärker suppri­mierten Linien schon überschritten haben. Diese Punkte
könn­ten Gegenstand weiterführender Untersuchungen sein.
4.2.4 Akklimatisierungseffekte in den Fd I-Mutanten
Neben den Kurzzeitmechanismen, die über eine Anpassung der
Quantenausbeuten, Photoin­hibi­tion und über alternative
Elektronenflüsse sichtbar wurden, traten in den transgenen Pflan­zen
auch Effekte auf, die klar einer Langzeitakklimatisierung
zuzuschreiben sind. Deutliche Unterschiede waren in den
Chlorophyllgehalten sowie im Chlorphyll a/b-Verhältnis meßbar
(s. Abb. 26A und 26B), und die Linien mit den geringsten Gehalten an
Fd I zeigten klare An­zeichen von Photoinhibition.
In Bezug auf die Chlorophyllgehalte wiesen die Unterexprimierer ein
erhöhtes und die Übe­rexprimierer ein verringertes Chlorophyll
a/b-Verhältnis auf. Derartige Veränderungen werden häufig beobachtet,
wenn Pflanzen eine Adaptation an veränderte Lichtintensitäten
durchlaufen. Die an den transgenen Fd I-Pflanzen erhobenen Befunde
deuten darauf hin, daß die Licht­adapta­tion in den transgenen
Pflanzen durch die veränderten Fd I-Gehalte gestört ist.
Es existieren viele Hinweise, daß der Redoxzustand der Komponenten des
photosynthetischen Elektronentransportes und/oder auch einige im
Stroma lokalisierte Komponenten Signale wei­ter­geben, die derartige
Anpassungen bewirken (aktueller Review: Link 2000). In der
einzelli­gen Alge Dunaliella beispielweise verursacht eine zehnfach
erhöhte Lichtintensität einen An­stieg des Chlorophyll
a/b-Verhältnisses um 50% und einen dreifachen Anstieg der absoluten
LHC II-Menge (La Roche et al. 1991). Hierbei wird angenommen, daß
diese Akklimatisie­rung durch den PS II-Anregungsdruck (1-qP)
hervorgerufen wird (Fujita et al. 1987). Generell wird die
LHC II-Synthese auf Ebene der Transkription reguliert. Im Fall von
Dunaliella konnte anhand von Inhi­bitor-Experimenten nachgewiesen
werden, daß der Redoxstatus von PQ als Photosensor-System agiert und
daß an der Signaltransduktion vom Chloroplasten in den Kern eine
Phosphorylie­rungskaskade beteiligt ist (Escoubas et al. 1995, s.u.,
Durnford & Falkowski 1997). Demge­genüber demonstrierten Savitch et al. (1996)
in Chlorella, daß der PS II-Anregungsdruck mögli­cherweise nur eine
Komponente eines komple­xen, mehrere Komponenten umfassenden
Sig­nal/Sensor-Systems ist, das die Schwach/Starklichtanpassungen
reguliert.
Auch in höheren Pflanzen erfolgt eine Adaptation der Pflanzen an
höhere bzw. niedrigere Licht­intensitäten über eine Veränderung in der
Größe der Licht-sammelnden Antennen (Melis 1991, Andersson & Aro
1997). Unter diesen Bedingungen ermöglicht eine Veränderung im
Verhältnis von Chlorophyll a zu Chlorophyll b den Pflanzen eine
Akklimatisierung an die sich verändernden exogenen Faktoren (Anderson & Osmond
1987). Das Chlorophyll a/b-Verhält­nis stellt somit eine Möglichkeit
dar, Veränderungen in der LHC-Menge leicht zu quantifizie­ren.
Beispielsweise geht in Blättern von Winterroggen eine Erhöhung der
Lichtintensität von 50 µE auf 800 µE mit einem Anstieg des
Chlorophyll a/b-Verhältnisses von 2,86 auf 3,57 ein­her (Gray et al. 1998).
Es existie­ren gute Hinweise, daß eine derartige Aufnahme und
Wei­terleitung von Signalen aus der Umwelt, die z.B. zu einer
Anpassung der vorliegenden Menge an Photosystemkomponenten führt, über
die photosynthetischen Elektronentransportketten und nicht durch das
Phytochrom-System vermittelt werden (Walters & Horton 1994, Tullberg
et al. 2000). Interessanterweise trat in den „antisense“-Pflanzen ein
dauerhaft er­höhtes Chlorophyll a/b-Verhältnis von z.B. 4,1 in der
Linie A99 im Vergleich zu 3,5 in den Wildtyp-Pflanzen auf. Die
qP-Werte hingegen waren sehr niedrig, was auf ei­nen stark erhöh­ten
Elektronendruck und einen hohen Reduktionsgrad von PQ hinweist. Die
mode­rat suppri­mierten Pflanzen wiesen nicht so stark erniedrigte
qP-Werte auf und auch das Chlorophyll a/b-Verhältnis war nicht so
stark erhöht wie in den Pflanzen mit dem geringsten Fd I-Gehalt. In
den „sense“-Pflanzen hingegen war qP bei einer gleichzeitig
auftretenden Abnahme des Chloro­phyll a/b-Verhältnisses leicht erhöht
(s. Abb. 26B und 30B). Offensichtlich erfolgt in Abhängig­keit von der
jeweiligen Fd I-Menge, und letztendlich vermutlich durch den im Stroma
vorliegen­den Akzeptormangel bedingt, eine Erhöhung bzw. Erniedrigung
des qP, was dann eine unter­schiedliche Adaptation des Chlorophyll
a/b-Verhältnisses nach sich zieht. Bezug nehmend auf die Ergebnisse,
die für Winterroggen vorliegen, können diese Ergebnisse in der Form
gedeutet wer­den, daß ein verringerter Fd-Gehalt bei den
„antisense“-Pflanzen zu einer Anpassung in Richtung Starklicht führt.
Bei den „sense“-Pflanzen ergibt sich dann das genau umgekehrte Bild,
näm­lich eine mehr zum Schwachlicht hin orientierte Adaptation (s.
Abb. 43).
Bei den Fd I-über- und unterexprimierenden Pflanzen könnte u.a. der
von Escoubas et al. (1995) vorgeschlagene Mechanismus zur
Lichtanpassung von Dunaliella grei­fen. Die Akklimatisierung der Alge
an niedrige Lichtintensitäten erfolgt über eine Zunahme in der LHC
II-Apoproteinmenge und im Chlorophyll a-Gehalt. Bei Anpassung an hohe
Lichtintensitäten wird der umgekehrte Weg beschritten. Eine Hemmung
der Starklichtanpas­sung konnte partiell durch DCMU hervorgerufen
werden. Unter diesen Bedingungen liegt PQ oxidierter vor, was dann
eine nachgeschaltete Phosphorylierungskaskade inaktiviert. Über
„electrophoretic mobility shift assays“ konnten die Autoren direkt
eine verringerte Bindung eines cab-Gen-Repressor-Faktors an die „light
respon­sive elements“ des cab-Gens im Nukleus nachweisen. Dies führte
dann wie unter Schwachlicht zu einer vermehrten Expression des LHC
II-Apoproteins und zu einem erhöhten Chlorophyll a-Gehalt. Eine
ähnliche Situation liegt in der Elektronentransportkette der Fd
I-„sense“-Pflanzen vor, während die „antisense“-Pflanzen das genau
umgekehrte Bild bieten (s. Abb. 46). Zusätzlich kann auch der jeweils
in entgegengesetzter Richtung veränderte Redoxzustand im Stroma auf
diese Anpassung wirken, indem durch die Regulation der schon oben
angesprochenen Protein-Kinase ein verstärkender Effekt auftritt. In
diesem Fall würde das gleiche Sensor-System, welches kurzzeitige,
rever­sible Änderungen in der Lichtanpassung reguliert, auch die
Langzeitadaptation bewirken.
Neben der verringerten Expression von LHC II konnte in der
Akklimatisierungsphase an Stark­licht eine steigende Aktivität einer
Protease nachgewiesen werden, die mit der Stroma­thylakoid­membran
assoziiert ist und LHC II degradiert (Lindahl et al. 1995, Yang et al.
1998). Dabei stellt die phosphorylierte Form von LHC II kein Substrat
dar, während nicht-phosphoryliertes LHC II schnell abgebaut wird.
Dieser Prozeß schließt somit eine Dephospo­rylierung ein. Es wur­den
mehrere Phosphatasen beschrieben, die mit dem Cyt bf-Komplex
assoziiert sind und von denen einige anscheinend einer Redoxregulation
unterliegen (Elich 1993, Carlberg & Andersson 1996). Nach Anpassung an
die neue, höhere Lichtintensität erfolgt eine Inaktivierung der
Protease (Yang et al. 1998). Die Daten haben Anlaß zu der Vermutung
gegeben, daß die Be­deutung der Phosphorylierung darin liegt, LHC II
durch late­rale Wanderung von den Granathyla­koiden in die
Stromathylakoide zu bringen, wo die Pro­tease lokalisiert ist (Andersson & Aro 1997,
Yang et al. 1998, Vener et al. 1998). Dieser extrem komplexe
Regelkreis zwischen Neu­synthese und Abbau, der im Endeffekt die
Anpas­sung an die gegebenen Lichtverhältnisse regu­liert, scheint
zumindest in den transgenen Fd I-„antisense“-Pflanzen unterbrochen zu
sein.



A bbildung 43: Schematische
Darstellung der möglichen Auswirkungen von erhöhten und erniedrigten
endogenen Gehalten an Fd I auf die Expression von Kern- und/oder
Chloroplasten-kodierten Protei­nen. Im oberen Teil der Abbildung sind
die Vorgänge für die Fd I-„sense“-Linien und im unteren Teil die
jenigen für die Fd I-„antisense“-Linien dargestellt. Aus den
veränderten Chlorophyll a/b-Verhältnissen und den aus der Literatur
hervorgehenden Daten wird deutlich (vgl. Text), daß der Redoxzustand
im Chlorplasten einen ent­scheidenden Einfluß auf die Expression von
Chloroplasten-kodierten, aber auch Kern-kodierten Bestandteilen hat.
Elektronentransportkette: Erhöhter bzw. erniedrigter Reduktionsgrad
von PQ-„pools“ und Cyt bf-Kom­plex ( Fd I-„antisense“, Fd I-„sense“)
beeinflußt die Expression von PS II- und LHC II-Untereinheiten (Signal
im Stroma und Kern). Änderungen im Elektronendruck zwischen den
Photosystemen werden immer durch die Elektronen-verbrauchenden
Reaktionen im Stroma beeinflußt. Stroma: Vom Re­duktiongrad im Stroma
( Fd I-„antisense“, Fd I-„sense“) können ebenfalls Signal(e) ausgehen,
die die Expression von Pro­teinen in Stroma und Kern beeinflussen. Cytosol:
Das/Die Signal(e) müssen über die Hüllmembran gelangen. Beteiligte
„Carrier“ sind nicht bekannt ( ). Einfluß auf Trans-kription über z.B.
Akti­vierung von Transkriptions­faktoren und/oder auf die Translation.
Kern: Transkription von im Chloroplasten lokalisierten Proteinen nach
signalisiertem Bedarf.
Verkompliziert wird dies zusätzlich dadurch, daß die graduell
verschiedene Expression von Fd I unter den hier getesteten Bedingungen
zu verschiedenen Phänotypen führt. Die Gruppe der Pflan­zen mit einer
Fd I-Expression von durchschnittlich 80% der in Wildtyp-Pflanzen
enthaltenen Menge kann den erhöhten Elektronendruck in der
Elektronentransportkette bei einem verglichen mit Wildtyp-Pflanzen
verringerten Redoxzustand im Stroma über die Dauer einer
Vegetations­periode balancieren. Dabei scheint die Regulation über den
erhöhten DpH und/oder als Folge über eine veränderte Verteilung der
Anregungsenergie, sowie die Reduk­tion in der Antennengröße zu
greifen. Eine noch größere Auslenkung des Systems führt dann aber zu
einem Phänotyp, der auch bei Anzucht unter moderaten Lichtintensitäten
dauerhafte Photoinhibition zeigt. In intakten Blättern kann
Photoinhibition nur unter Bedingungen detek­tiert werden, unter denen
die Schädigung von PS II die Kapazität derjenigen Reaktionen
über­steigt, die PS II reparieren (Melis 1999, Baena-González et al.
1999). Voraussetzung für eine Degradation von D1 in PS II ist die
Licht-induzierte Inaktivierung des Elektronentransfers von PS II.
Diese Inaktivierung von PS II wird von photo-oxidativen Schädigungen
begleitet, die insbesondere D1 schädigen und dieses mög­licherweise
über Konformationsänderungen in ein Substrat für die nachfolgende
Proteolyse verwandeln (Andersson & Aro 1997). Photo-oxidative
Schädigungen treten an der Akzeptorseite von PS II auf, wenn QA zu dem
Zeitpunkt reduziert vorliegt, an dem durch Anregung die
Ladungstrennung zwischen dem Reaktionszent­rum P680 und Phaeophytin
stattfindet (Melis 1999). Die Folge können dann sogenannte „charge
recombinations“ sein, die zu einer lokalen Bildung von hoch reaktiven
Singulet-Sauer­stoff-Radikalen führt. Die Radikale modifizieren
ver­schiedene Komponenten in PS II, zu denen auch P680 und P680+
gehören. Auch eine Inaktivierung von PS II an der Donorseite führt zur
Bildung von langlebigen Radikalen (P680+, Tyrosinz+) (Sharma et al. 1997).
Beide Vorgänge rufen die Oxidation von in der Nähe lokalisierten
Pig­menten, Redox-Komponenten und Aminosäuren hervor (Sharma et al. 1997,
Melis 1999). Die Wahrscheinlichkeit einer Schädigung von D1 wird durch
hohe Lichtintensitäten, große Antennengröße, CO2-Limitie­rung und
suboptimale Temperaturen erhöht, was wiederum den Zusammen­hang
zwischen dem Verbrauch der bereitgestellten Elektronen im Stroma und
deren Bereitstellung verdeutlicht (Baroli & Melis 1998, Krömer et al. 1993,
Huner et al. 1996). So führen Bedingungen, die die Rate der
Photosynthese limitieren oder die Rate der Lichtabsorption relativ zum
Elektro­nentransport erhöhen, zu einer Überreduktion des PQ-„pools“ (Zer & Ohad
1995), ein Zu­stand, der die Wahrscheinlichkeit einer photooxidativen
Schädigung erhöht (Melis 1999). Für die Fd I-unterexprimierenden
Pflanzen scheint die Bereitstellung von Elektronen für eine
sätti­gende CO2-Fixierung durch die verminderte Fd I-Menge limitiert
zu sein (vgl. oben). Selbst bei moderater Lichteinstrahlung liegt ein
wesentlich höherer Anteil der PQ-Moleküle wesent­lich reduziert vor
als in den Kontrollpflanzen (s. Abb. 30B). Der stark reduzierte
PQ-„pool“, kann wie oben erläutert, der Auslöser für eine derart
starke photo-oxidative Schädigung sein als deren Folge Photoinhibition
eintritt. Der Zustand in den stärker unterexprimierenden Linien
entspricht dann wahrscheinlich einer dauer­haften Streßsituation, wie
sie z.B. bei CO2-Limitie­rung oder bei niedrigen Temperaturen
auftritt, und an die sich die Pflanze nicht anpassen kann.
In diesem Aspekt scheinen die Fd I-„sense“-Pflanzen einen Vorteil
gegenüber den „antisense“- und auch den Wildtyp-Pflanzen zu besitzen,
da sie unter den hier angelegten Bedingungen eine höhere
photosynthetische Effizienz zeigten (s. Abb. 30A). Auf der Grundlage,
daß ein erhöhter Reduktionsgrad von PQ eher zu photooxidativen
Schädigungen führt, müssten diese Pflanzen einen höheren Schutz gegen
Photoinhibition besitzen. Um dies weiter zu untermauern, wäre eine
weiterführende Charakterisierung der „sense“-Pflanzen, z.B. bei
Anzucht unter Starklicht, not­wendig.
Vom höheren bzw. niedrigeren Reduktionsgrad von PQ könnten
auch Signale weitergegeben werden, die wie für Erbse beschrieben (Tullberg et al. 2000)
zu einer erhöhten bzw. ernied­rigten Transkription der Untereinheit B
des PS I führen. Bei dieser Art der Regulation bleibt allerdings noch
offen, inwiefern sich auch die Expression der anderen Untereinheiten
von PS I ändert, da allein die erhöhte Expression von psaB nicht zu
mehr funktionalem PS I führen würde. Die quanti­tative Bestimmung der
Expression von PS I-Untereinheiten in den Fd-„sense“- und
„anti­sense“-Pflanzen könnte aber durchaus weitere Hinweise über den
zu Grunde liegenden Mecha­nismus liefern.
Zusätzlich zu diesen Befunden existieren ebenfalls Evidenzien, daß auf
Ebene des PS I oder von Komponenten, die danach lokalisiert sind,
mindestens eine weitere Stelle existiert, die Redox-Signale
weitergibt. Diese kontrolliert ganz eindeutig die Transkription und
Translation von vielen Chloroplasten-kodierten Enzymen (vgl. Abb. 43).
Eine Möglichkeit dieser Regula­tion wird über Thioredoxin vermittelt
und resultiert in der Reduktion von regulatorischen Disul­fidbrücken
in einem spezifischen Aktivator-Protein (Kim & Mayfield 1997). Andere
Änderungen in der Aus­stattung des Plastiden mit Proteinen oder
Pigmenten, die im Kern ko­diert sind, können mögli­cherweise über eine
Akkumulation von H2O2 (van Camp et al. 1999) oder über den Redoxstatus
von Glutathion (Karpinski et al. 1999) signalisiert werden. Diese Art
der Signalweiterleitung wird oft mit oxidativem Streß in Verbindung
gebracht und beeinflußt die Expressionshöhe von Enzymen wie
Superoxid-Dismutase und Ascorbat-Peroxi­dase (Schreck et al. 1991),
die den antioxidativen Stoffwechselwegen zugeordnet sind. Es bestehen
weiterhin gute Hinweise, daß ebenfalls die Expression der NADP-MDH
durch einen erhöhten Redox-Zustand im Chloroplasten erhöht wird (Backhausen & Scheibe
1998). Obwohl in den Fd I-„antisense“-Pflanzen der PS
II-Anregungszustand stark erhöht ist, ist die Kapazität dieses Enzyms
unverändert (s. Abb. 26D). Demgegenüber bewirkt in diesen Pflan­zen
der hohe Reduktionsgrad der Elektronentransportkette die Weitergabe
eines Signals, das zu einer verminderten LHC II-Expression führt (s.
Abb. 26B). Auf der anderen Seite bleibt aufgrund der reduzierten Menge
an Fd I der Redoxzustand von sämtlichen stromalen Kompo­nenten sehr
niedrig. Unter dieser Annahme kann daraus die Schlußfolgerung gezogen
werden, daß Änderungen in der NADP-MDH-Expression durch Signale
hervorgerufen werden, die offensichtlich hinter PS I bzw. Fd
lokalisiert sind. Diese könnten dann von stromalen
Elektro­nenüberträgern, wie z.B. Glutathion, ausgehen.
Aus den vorliegenden Daten wird deutlich, daß bei der Regulation der
Genexpression der Re­doxstatus des Chloroplasten offensichtlich eine
herausragende Rolle spielt. Die Einfluß neh­men­den Faktoren
unterliegen dabei sehr komplexen und vor allem sich untereinander
beein­flussenden Regulationsmechanismen. Da sowohl vom stromalem
Redoxzustand als auch vom Elektronendruck in den
Elektronentransportketten Signale ausgehen, stellen diese beiden
Komponenten anscheinend ein Sensor-System dar, das über die Aufnahme
der aktuellen Situ­ation im Chloroplasten eine Anpassung an veränderte
Umwelteinflüsse ermöglicht. Da die daran beteiligten Komponenten nach
wie vor nicht identifiziert sind, stellen die transgenen Fd-Pflanzen
aufgrund ihres Ungleichgewichtes im Reduktionsgrad von Stroma und
Elektronen­transport gute Unter­suchungsobjekte dar, um
redoxgesteuerte Genexpression zu untersuchen.
4.3 Transgene Kartoffelpflanzen mit veränderten Gehalten an FTR B
Die Hauptzielsetzung dieser Arbeit war, die Auswirkung von veränderten
Elektronenflüssen auf den Chloroplasten zu untersuchen. Sämtliche
Manipulationen an der Elektronenbereitstel­lung im isolierten
Chloroplasten beeinflussten immer mehrere Parameter (s. dazu Kap.
4.1). Um weitere Infor­mationen zu dieser Fragestellung zu erhalten,
wurden transgene Pflanzen hergestellt, die verän­derte stromale
Gehalte von zentralen Elektronenüberträgern, wie Fd I (s.
dazu Kap. 4.2) und FTR auf­weisen. FTR ist in diesem Zusammenhang
insofern von Interesse, da durch eine Über- bzw. Un­terexpression
dieses Enzyms nur der Elektronenfluß auf Td f und Td m, und im
weiteren dann auf die durch Td regulierten Proteine verändert wird.
Strukturell besteht FTR aus zwei heterologen Untereinheiten: der
variablen Untereinheit FTR A und der katalytischen Untereinheit FTR B
(Droux et al. 1987a). Über die Regulation der Expres­sion der beiden
Untereinheiten in vivo ist nichts bekannt. Für eine Erniedrigung oder
Erhöhung des Proteingehaltes im Chloroplasten stellte sich somit
erstens die Frage, ob eine Coregulation in der Expression beider
Untereinheiten stattfindet. Zweitens bestand auch die Möglichkeit, daß
eine effiziente Drosselung der Proteinmenge nur nach einer
Transformation mit beiden Unterein­heiten stattfindet. Da die
FTR B-Untereinheit sehr konserviert ist (s. Tab. 6) und die
katalytische Untereinheit des Enzyms darstellt (Dai et al. 2000a und
2000b), erfolgte in einem ersten Ansatz eine Über- und Unterexpression
im heterologen System. Dazu wurde die bereits in unserem Labor
isolierte cDNA-Sequenz von FTR B aus Spinat in „sense“- und
„antisense“-Orientierung über A. tumefaciens vermittelten Gentransfer
in das Pflanzengenom eingebracht. Dies führte zu keiner stabilen
Unterexpression der FTR B-Untereinheit, da nach einem zweiten
Gewebekulturschritt dieser Effekt aufgehoben war. Auf­grund der
Ineffektivität dieses Ansatzes (s. Kap. 4.3.3) erfolgte anschließend
die Isolierung von Kartoffelblatt ftr b- und ftr a-cDNA-Klonen, um
auch einen homologen Transformations­ansatz starten zu können.
4.3.1 Charakterisierung der Transitpeptide der FTR-Untereinheiten aus
Kartoffel
Die bislang identifizierten FTR A- und FTR B-cDNA-Sequenzen sind mit
einer N-terminalen Sequenzerweiterung versehen (Falkenstein et al. 1994,
Marc-Martin et al. 1993, Raeber et al. 1998). Die Sequenzerweiterung
kodiert für ein Transitpeptid, welches für den Transport über die
Chloroplastenhüllmembran benötigt wird. Nach dem Transfer werden diese
Präse­quenzen im Stroma unter ATP-Verbrauch von einer Peptidase
abgespalten wird (Grossmann et al. 1980, Gray & Row 1995, Richter & Lamppa
1998). Für alle transgenen Ansätze, in denen Pflanzen hergestellt
werden, die ein im Chloroplastenstroma lokalisiertes Protein
überexprimieren sollen, ist es ratsam die vollständige für das
entsprechende Präprotein kodierende Sequenz in die Pflanze zu
transferieren. Auch eine Unterexpression scheint effek­tiver zu
greifen, wenn der zumindest N-terminal vollständige Klon in die
Pflanze transferiert wird (A. von Schaewen, persönliche Mittei­lung).
Der in dieser Arbeit isolierte ftr a-cDNA-Klon aus Kartoffel kodiert
höchstwahrscheinlich für die gesamte Länge des Präproteins. Diese
Annahme beruht hauptsächlich auf dem Befund, daß die Nukleotide,
welche das Start-Methionin umgeben, denen eines starken Startkodons
für die Trans­lation pflanzlicher Präproteine entsprechen (Lütcke et
al 1987). Relativ zum angenom­menen Translationsstart wurde in
Position –3 und in Position +4 ein Adenin bestimmt (s. Abb. 33). Ein
weiter im 5’-Bereich gelegenes Stopkodon, welches den Hinweis auf den
korrekten Translationsstart untermauern würde, ist nicht vorhanden.
Auch die Basen um den angenommen Translationsstart von FTR B aus
Kartoffel stimmen mit der von Lütke et al. (1987) bestimmten Motiv
überein (s. Abb. 35). Das in Position –16 bis –18 be­findliche
Stopkodon TAA belegt diesen Befund. Auch die für Transitsequenzen im
N-Terminus ungewöhnlich hohe Übereinstimmung zu der Sequenz aus Spinat
weist auf den kor­rekten Trans­lationsstart hin (vgl. Abb. 36A). Ein
weiter „stromaufwärts“ liegendes Methionin wurde nicht gefunden.
Die Einteilung der FTR A-Untereinheit in Transitpeptid und reifes
Protein erwies sich als schwie­rig und erfolgte unter Berücksichtigung
der abgeleiteten Aminosäuresequenz aus Spinat (Falkenstein et al. 1994)
und der über Proteinsequenzierung bestimmten FTR A-Sequenz aus Mais (Iwadate et al. 1996).
Eine sehr gute Übereinstimmung in der Länge der Präproteine ergab der
Vergleich mit Spinat. FTR A aus Spinat setzt sich aus 174 Aminosäuren
zusammen und der abgeleitete Kartoffel-Klon wies eine Länge von 171
Aminosäuren auf. Die Prozessie­rungsstelle für Spinat war u.a. anhand
der Mais-Sequenz festgelegt worden (Falkenstein 1995). Beide Pro­teine
würden dann mit der Aminosäurefolge Glu-Val-Ala beginnen
(s. Abb. 34A). Dieses Motiv war in der Sequenz aus Kartoffel nicht
vorhanden. In der Amino­säurefolge Ser-Val-Thr (beginnend bei Position
60) ist Valin identisch, Threonin hoch konser­viert zu Alanin und auch
Serin ist konserviert verglichen mit Glutaminsäure (s. Abb. 34 B).
Identisch ist in beiden Sequenzen auch das drei Aminosäuren weiter
N-terminal gelegene Iso­leucin. Zusammen­gefaßt stimmt dieser Bereich
in beiden Sequenzen weitestgehend mit dem von Gavel & von Heijne
(1990) analysierten Prozessierungsmotiv (Ile/Val)-X-(Ala/Ser/Cys)¯(Ala/Ser/Cys/Met)
überein. Eine Computer-gestützte Analyse des FTR A-Präproteins mit dem
Programm „ChloroP“, welches zur Erken­nung der chloroplastidären
Transitpeptide und deren Spaltstellen entwickelt wurde (Emanuelsson et al.
1999), wies die Sequenzerweiterung zwar als Transitpeptid aus, aber
die Spaltstelle wurde nach Position 76 festgelegt. Von den 715 mit
diesem Programm getesteten A. thaliana-Sequenzen fanden die Autoren
bei mindestens 60% der in SWISS-PROT angegebe­nen Spaltstellen eine
Überein­stimmung (± 2 Reste). Die Abweichungen bei FTR A, könnten auf
extreme Sequenz-Unter­schiede zwischen Kartoffel und A. thaliana
zurückzuführen sein. In die­sem Zusammenhang kann noch auf die Befunde
von de Boer & Weisbeek (1991) verwiesen werden, welche eine generell
nur schwache Übereinstimmung in dem Sequenzabschnitt um die
Spaltstelle fanden. Abgeleitet von den Sequenzvergleichen ist das
Transitpeptid von Kartoffel-FTR A dann mit einer Länge von 59
Aminosäuren vergleichbar zu dem Transitpeptid von Spinat (62
Amino­säuren).
Bei FTR B aus Kartoffel war mit der Aminosäurefolge Val-Ala-Lys-Met
eine recht gute Über­ein­stimmung mit der Konsensussequenz vorhanden
(s. Abb. 35). Bei FTR B aus Spinat (Falkenstein et al. 1994), aus Soja
(Raeber et al. 1998) und aus Mais (Marc-Martin 1993) fehlt dieses
Motiv, während in den jeweils reifen Proteinen die erste Aminosäure
überein­stimmt (s. Abb. 36). Die folgenden Aminosäuren in Position +2
bis +5 im reifen Protein sind hingegen bei Spinat, Kartoffel und Soja
identisch (s. Abb. 36B), so daß die Spaltstelle in Kar­toffel zwischen
Position 35 und Position 36 als richtig anzunehmen ist (s. Abb. 35).
Auffällig sind auch hier wie­der die Unterschiede in den
Sequenzabschnitten um die angenommenen Spaltstellen zwischen den
verschiedenen Arten. Die Analyse mit „ChloroP“ ergab eine recht gute
Übereinstimmung in Bezug auf die Prozessierungsstelle. Für die
Sequenzen aus Kartoffel und Soja (Raeber et al. 1998) läge die
Spaltstelle jeweils zwei Aminosäuren weiter in Rich­tung N-Terminus.
Besonders im Fall von Spinat ergäbe sich, wie schon von Falkenstein
(1995) beschrieben, eine wesentlich bessere Übereinstimmung mit dem
Konsensusmotiv. Grö­ßere Ab­weichungen wurden für Spinat (Falkenstein et al. 1994)
und Mais (Marc-Martin et al. 1993) berechnet. Diese sind für Spinat
anhand der Sequenzvergleiche kaum haltbar, da die Spaltstelle nach
Computer-Analyse um neun Aminosäuren weiter im reifen Protein liegen
würde und dann in einem Bereich liegen würde, der in allen
FTR B-Unterein­heiten sehr konserviert ist (Position 44, s. Abb. 36B).
4.3.2 Charakterisierung der reifen FTR-Untereinheiten aus Kartoffel
Die funktionale FTR besteht als Heterodimer aus der variablen FTR A-
und der konservierten FTR B-Untereinheit. Die variable Untereinheit
weist zwischen den verschiedenen bisher be­kannten Organismen starke
Unterschiede in der Primärstruktur auf (vgl. Abb. 34B). Dies deckt
sich mit den Ergebnissen von Droux et al. (1987a), welche
unterschiedliche Moleku­largewichte für FTR A aus verschiedenen
Organismen beschrieben. Die Untereinheit aus Anacystis nidulans stellt
mit einer Sequenzlänge von 73 Aminosäureresten das kleinste
FTR A-Protein dar. Eine mittlere Stellung nimmt FTR A aus Mais ein (97
Reste). Die in dieser Arbeit identifizierte Sequenz aus Kartoffel
wäre, unter Annahme der in Kapitel 4.3.1 disku­tierten Spaltstelle,
mit 112 Aminosäuren in der Länge identisch zur Spinatsequenz (Falkenstein et al. 1994, Iwadate et al. 1994)
(s. Abb. 34). Beim Vergleich der Unterein­heiten fallen die im reifen
Protein von höheren Pflanzen vorhandenen N-terminalen
Sequenz­verlängerungen auf (15-30 Aminosäuren) (s. Abb. 34A).
Vermutlich sind die Unterschiede in der Molekülmasse haupt­sächlich
auf diese Verlängerungen zurückzuführen (Iwadate et al. 1994, 1996).
Der Amino­säurevergleich von Kartoffel mit anderen bekannten Sequenzen
ergab eine Identität von 43% zur Sequenz aus Spinat (Falkenstein et al. 1994),
von 47% zur Sequenz aus Mais (Iwadate et al. 1996) und die sehr
geringe Identität von 25% zur Sequenz aus Anacystis nidulans (Szekeres et al. 1991)
(s. Tab. 5). Durch den Vergleich zwischen den verschiedenen Spezies
wurden die auch von Iwadate et al. (1996) beschriebenen drei Domänen
erkennbar, die hö­here Homologien zueinander aufwiesen als die übrigen
Bereiche der Proteine (s. Abb. 34A). Anhand der Kristallstruktur von
FTR aus Synechocystis konnte gezeigt werden, daß diese Domänen in die
Interaktion mit der katalytischen Untereinheit involviert sind (Dai et
al. 2000a und 2000b). FTR A bildet eine aus offenen ß-Faltblättern
bestehende Struktur aus, die fünf antiparallele Stränge beinhaltet
(ß1-ß5, ß1: Domäne1, ß3: Domäne 2, ß4 und ß5: Do­mäne 4 und 5). Sowohl
zwischen ß1 und ß2 als auch zwischen ß2 und ß3 ist jeweils eine
Schleife („loop 1“ und „loop 2“) eingeschoben, so daß FTR A die Form
eines Herzens hat, wobei die beiden Schleifen den oberen Teil bilden.
„loop 2“ enthält einen „ß-hairpin“ mit den Strängen ßA und ßB
(Domäne 2) und stellt den Haupt-Interaktionsbereich mit der
katalytischen Unter­einheit dar (Dai et al. 2000a und 2000b). In
Synechocystis bilden die Aminosäurereste Phe­nylalanin 71, Tryptophan
72, Valin 77 und Prolin 78 der katalytischen Untereinheit mit den
Resten Alanin 49, Leucin 51 und Histidin 64 der variablen Untereinheit
einen kleinen hydro­phoben Kern, der im Zentrum des Dimers liegt.
Diese Aminosäuren sind in den Untereinhei­ten von Kartoffel
konserviert (entsprechend Position Ala 77, Leu 79, His 100 in FTR A
und Phe 68, Trp 69, Val 74, Pro 75 in FTR B, s. Abb. 34). Die meisten
Interaktionen scheinen aber zwi­schen polaren und unpolaren Resten der
Untereinheiten in Form von Wasserstoff-brückenbin­dungen aufzutreten.
Dabei scheinen die Positionen (FTR A: His 102, Glu 107, Tyr 46, FTR B:
Glu 78, Arg 79, Glu 63) in Kartoffel sowie bekannten
FTR-Untereinheiten ande­rer Pflanzen­arten sehr konserviert zu sein.
Eine Ausnahme bildet das für Synechocystis-FTR A beschrie­bene Arginin
45, das in allen in Abbildung 34A dargestellten Spezies gegen ein
Lysin ausge­tauscht ist. Zwischen weiteren Resten von FTR A
(Kartoffel: Ser 76, Tyr 46, His 47) bilden sich van der Waals-Kräfte
zu den entsprechenden Aminosäuren in FTR B (Kartoffel: Glu 78, Arg 79)
aus. Ebenfalls involviert ist in FTR A aus Synechocystis Thryptophan
42, das in allen untersuchten Spezies konserviert ist, aber in Tomate
und Kartoffel gegen Histidin (Kartoffel: Position 70) ausgetauscht
ist. Da die meisten Reste, die an der In­teraktion der Untereinheiten
beteiligt sind, konserviert sind, scheint eine wichtige Funktion der
variablen Untereinheit die Stabilisierug des Fe-S-Zentrums der
B-Untereinheit zu sein (Dai et al. 2000a). Dies wird von dem Befund
gestützt, daß die Farbe von FTR (hervorgeru­fen durch das
Fe-S-Zentrum) bei Dissoziation in die Untereinheiten verloren geht (Dai et al. 2000a).
Sämtliche Cysteine, die an der Bindung des Fe-S-Zentrums beteiligt
sind, sind in den FTR B-Untereinheiten von Kartoffel, Soja und Spinat
an konservierten Positionen lokalisiert (Position 52, 71, 73, 82;
s. Abb. 36). Aufgrund eines zusätzlichen Asparaginrestes im
N-terminalen Be­reich des Proteins sind die entsprechenden Positionen
in der Untereinheit aus Mais die Positio­nen 53, 72, 74 und 83. In
Synechocystis erfolgt die Koordination der Fe-Atome durch die Cysteine
in Position 55, 74, 76 und 85 (Dai et al. 2000A und 2000B). Auffällig
ist, daß das Bindungsmotiv für das Fe-S-Zentrum in allen FTR
B-Untereinheiten von dem üblichen Motiv Cys-X-X-Cys anderer
Fe-S-Zentren enthaltender Proteine abweicht (X steht für eine
beliebige Aminosäure). In FTR B sind sämtliche Liganden in kurzen
Sequenzmotiven (Cys-X-Cys) loka­lisiert, die zusammen ein bislang
einzigartiges Motiv mit der Folge Cys-Pro-Cys-X16-Cys-Pro-Cys-X8-Cys-His-Cys
darstellen (am Fe-S-Zentrum beteiligte Cys sind fett gedruckt; Dai et
al. 2000A). Die Cysteine des zentralen Cys-Pro-Cys-Motivs sind
Liganden des Fe-S-Zent­rums, während von den anderen beiden Motiven
jeweils nur ein Cystein involviert ist. Die verbleibenden zwei
Cysteine bilden die an der Reduktion von Thioredoxin beteiligte
redox-aktive Disulfidbrücke (Synechocystis: Cys 57 und Cys 87,
Kartoffel: Cys 54 und Cys 84) (Dai et al. 2000A und 2000B).
4.3.3 Transgene Kartoffelpflanzen mit erhöhten oder verringerten
Gehalten an FTR B
Die Transformation der Kartoffelpflanzen mit FTR B erfolgte analog zur
Transformation von Fd I durch A. tumefaciens vermittelten Gentransfer.
In den binären Vektor pDE1001 wurde die pflanzliche
Expressionskassette des Vektors pA35S inseriert, welche die zu
exprimierenden cDNA-Klone in „sense“ und „antisense“-Orientierung
enthielt. Von den getesteten unabhängi­gen Linien zeigten 78% eine
deutliche Überexpression der eingebrachten heterologen ftr b-cDNA. Auf
mRNA-Ebene wurde eine Überexpression von bis zu 1000% im Vergleich zu
den Wildtyp-Kartoffelpflanzen nachgewiesen (vgl. Abb. 39).
Die korrespondierenden Proteingehalte wurden auf der Basis analysiert,
daß vergleichbare FTR B-Proteingehalte in Blattextrakten von
Wildtyp-Kartoffelpflanzen und Spinatpflanzen vorhanden sind, die aber
mit dem Spinat-FTR B-Antikörper unterschiedlich stark detektierbar
sind. In der überexprimierenden Linie S104 kann dann lediglich auf
eine Verdopplung des Proteingehaltes geschlossen werden. Denn bei
Vergleich der in Abbildung 38A gezeigten Bandenmuster ist neben der
etwa gleichwertigen FTR B-Bande von S104 gegenüber
Wildtyp-Kartoffelpflanzen bei S104 eine zweite Bande etwa gleichwertig
mit der vergleichbaren Bande von Spinat-Blattextrakt. Schlußfolgernd
wird in den FTR B-überexprimierenden Kartoffel­pflanzen nur ein
prozentual geringer Anteil der Spinat-ftr b-mRNA translatiert und/oder
das gebildete FTR B-Präprotein wird in der Menge nicht über die
Chloroplastenhüllmembran transloziert.
Allerdings sind weitere Spekulationen darüber irrelevant, da in den
untersuchten transgenen Pflanzen keine parallele Erhöhung der FTR
A-Untereinheit bestimmt wurde. Deshalb kann nicht davon ausgegangen
werden, daß der Anteil an funktionaler FTR in den Chloroplasten dieser
Pflanzen überhaupt erhöht ist. Weiterhin ist anhand der vorliegenden
Ergebnisse für die untersuchten FTR B-Überexprimierer auszuschließen,
daß eine Induktion von ftr a-mRNA durch erhöhte Gehalte an ftr b-mRNA
stattfindet. Eine so gerichtete Coregulation kann hiermit
ausgeschlossen werden.
Gegenüber dieser erfolgreichen Überexpression von Spinat-FTR B in
Kartoffelpflanzen, war die Repression im heterologen System
offensichtlich nicht stabil. Ursache dafür könnte einer­seits eine
verringerte Expressionsrate des „antisense“-Konstruktes sein.
Hervorgerufen wird dieses durch z.B. endogene Methylierungsreaktionen
am CaMV-Promotor, die eine verringerte Bildung der „antisensense“-mRNA
zur Folge haben, wie es von anderen Gruppen für einge­brachte
Fremd­gene schon beobachtet wurde (Hobbs et al. 1990, Palmgren et al. 1993).
Ande­rerseits besteht die Möglichkeit, daß die Identität zwischen den
beiden FTR B-Untereinheiten, trotz einer 77%igen Übereinstimmung der
Präproteine (s. Tab. 6), nicht ausreichend für eine stabil reduzierte
Translationsrate ist. Für diese Variante spricht, daß eine zehn- bis
100fach geringere Kreuzre­aktivität zwischen den heterologen ftr b-Sequenzen
als zwischen den homo­logen besteht (s. Abb. 39). Aus diesem Grund
wurde dann für die zweite Transformation der ftr b-cDNA-Klon aus einer
Kartoffelblatt-Expressionsbibliothek isoliert (s. Kap. 3.3.2).
Nach Transformation und Regeneration von Kartoffelpflanzen mit dem
ftr b-„antisense“-Kon­strukt zeigte zumindest ein Anteil von 11,5%
aller getesteten primären Transformanten eine deutliche
Unterexpression. Dieser Anteil lag somit wesentlich höher als nach der
heterologen Transformation, bei der nur zwei Pflanzen unter 200
unabhängigen Linien identifiziert werden konnten. Im Vergleich zu den
Fd I-Transformanten, bei denen 91,7% eine Unterexpression aufwiesen,
scheint es schwieriger zu sein „antisense“-FTR B-Pflanzen zu erzeugen,
die einen stabil reduzierten Gehalt an FTR B-Protein aufweisen.
Vergleichbare Beobachtungen wurden auch für das Rieske-Protein und die
d-Untereinheit der ATPase gemacht (Price et al. 1995A). Über die
zugrunde liegenden Ursachen liegen für die einzelnen Zielsequenzen
bislang keine gesicherten Daten vor. Ein möglicher Grund wäre z.B. ein
diurnaler Rhythmus, in dem zu be­stimmten Zeitpunkten derart viel mRNA
des jeweiligen Gens gebildet wird, so daß die Menge an
„antisense“-mRNA nicht für die Abbindung der endogenen mRNA ausreicht.
Auch RNA-Stabilität und RNA-Wechselrate sind in diesem Zusammenhang
von Bedeutung. Daten müssten dementsprechend individuell für jede
mRNA-Spezies erhoben werden.
5 Zusammenfassung
Die in dieser Arbeit durchgeführten Untersuchungen dienten zur
Identifizierung von Faktoren, die das Zusammenspiel zwischen dem
photosynthetischen Elektronentransport und den Reaktionen im Stroma
koordinieren. Hierzu erfolgten Manipulationen von Elektronen- und/oder
Metabolit­verfügbar­keit im Chloroplasten. Als Untersuchungsmaterial
dienten zunächst isolierte Spinat-Chloroplasten unter sättigendem CO2
und Pi. Durch die Herstellung transgener Kartoffelpflanzen, welche die
zentralen Elektronenverteiler Fd I und FTR über- bzw.
unterexprimieren, wurde die Elektronenverfügbarkeit im Chloroplasten
dann dauerhaft verändert.
Auswirkungen von zusätzlichen Elektronenakzeptoren auf den
Chloroplastenmetabolismus
Die Zugabe von verschieden „starken“ Elektronenakzeptoren zu
Chloroplasten während der „steady state“-Photosynthese bei
ausreichendem Lichtangebot hatte zwei Effekte zur Folge. Ein moderater
Elektronenentzug (0,2 und 2 mM OAA, 0,2 mM Nitrit) beeinträchtigte
ausschließlich den Aktivierungszustand der NADP-MDH, während die
Aktivierungszustände von NAD(P)-GAPDH, FBPase und PRK nahezu
unverändert waren. Auch qN, der stromale Metabolitgehalt und die [14CO2]-Fixierung
waren nur geringfügig beeinflußt. qP hingegen war stark erhöht. Im
Gegensatz dazu inhibierten Nitrit bzw. Methylviologen in höheren
Konzentrationen die [14CO2]-Fixierung. Das ATP/ADP-Verhältnis stieg an
und das NADPH/NADP-Verhältnis war nahezu unverändert. Eine extreme
Erhöhung war im DHAP/PGA-Verhältnis und der stromalen FBP-Menge
meßbar. Die Aktivierungszustände von FBPase und NADP-MDH nahmen nach
Zugabe stark ab, während die Aktivierungszustände von NAD(P)-GAPDH und
PRK unbeeinflußt blieben.
Zusammenspiel von Elektronenangebot und Effektoren auf die
Redoxmodulation von Chloroplastenenzymen
Eine Veränderung im Elektronenangebot durch variierende
Lichtintensitäten verdeutlichte, daß bei höheren Lichtintensitäten ein
Großteil der Elektronen nicht für die CO2-Fixierung genutzt werden
kann. Parallel zur Sättigung der CO2-Fixierung stiegen FBPase- und
NADP-MDH-Aktivierungs-zustände an, während PRK und NAD(P)-GAPDH schon
bei Intensitäten von 50 µE den maxi-malen Aktivierungszustand
erreichten. Die Zugabe von Intermediaten, die positiv bzw. negativ auf
den Aktivierungszustand der einzelnen Enzyme wirken, hatten wieder bei
NADP-MDH und FBPase die deutlichsten Auswirkungen. Sowohl
NAD(P)-GAPDH- als auch PRK-Aktivierungs-zustände waren nur unter
Bedingungen erniedrigt, unter denen der Elektronenfluß stark
herab-gesetzt ist und im Stroma wenig ATP, Triosephosphate und 3PGA
vorhanden sind. Demgegenüber reagiert NADP-MDH sehr sensitiv auf
Umlenkung oder Erhöhung des Elektronenflusses. Im Fall der FBPase
bestehen lineare Zusammenhänge zwischen FBP-Gehalt oder aktuellem
Elektronen-druck und dem Aktivierungszustand des Enzyms.
Die an Chloroplasten erhaltenen Ergebnisse zeigen:
Die Redoxmodulation im Licht spielt weder bei PRK noch bei
NAD(P)-GAPDH eine heraus-ragende Rolle. Die Bedeutung dieses
grundlegenden Regulationsmechanismus liegt für beide Enzyme im
Licht/Dunkel- und Dunkel/Licht-Übergang. Durch die „feed
back“-Regulation der NADP-MDH durch NADP erfolgt bei diesem Enzym
immer eine direkte Rückkopplung auf die Elektronenverfügbarkeit im
Stroma. Aufgrund der sensitiven Reaktion auf Änderungen im
NADPH/NADP-Verhältnis stellt das Enzym einen sehr guten Marker für den
im Stroma vorherrschenden Elektrondruck dar. Die sensitiven Schritte
im Calvin-Zyklus stellen die FBPase und die sehr ähnlich regulierte
SBPase dar. Der aktivierende Effekt von FBP auf die FBPase wird durch
den Elektronendruck in der Weise beeinflußt, daß eine Erhöhung der
Lichtintensität in höheren Enzymaktivitäten unter vergleichbaren
FBP-Konzentrationen resultieren. Bei einer Limitierung im
Elektronenangebot scheint die Aktivierung dann unabhängig vom
FBP-Gehalt zu sein. Restriktionen im Calvin-Zyklus, die zu einer
ver-minderten FBP-Bereitstellung bei hohem Elektronenangebot führen,
reichen für eine Aktivierung ebenfalls nicht aus. Somit stellt der
aktuelle Aktivierungszustand des Enzyms einen kombinierten Effekt aus
Elektronenverfügbarkeit und FBP-Gehalt dar.
Manipulation der Elektronenflüsse in vivo durch Veränderugen im
Fd-Gehalt
Die Transformation von Kartoffelpflanzen mit dem homologen fed 1-cDNA-Klon
(diese Arbeit) in „antisense“-Orientierung bewirkte eine maximal
50%ige Reduktion im Fd I-Proteingehalt. Eine weitere Reduktion im Fd
I-Gehalt scheint für die Pflanze letal zu sein. Sowohl moderat
supprimierte (80-100% des Wildtyp-Gehaltes) als auch stärker
supprimierte Linien (50-80%) wiesen verstärkten zyklischen
Elektronentransport und eine verringerte CO2-Assimilationsrate auf,
zeigten aber kein Anzeichen von O2-Reduktion. Als Schutz gegen
oxidativen Stress war in den „antisense“-Linien ein verminderter
Elektronenfluß nachweisbar, indem die Effizienz der Lichtnutzung von
PSI und PSII vermindert war. Dabei wurden zwei Strategien deutlich,
die aber beide zu weniger funktionellem PS II und verringerten
Quantenausbeuten führten: In den moderaten Linien war ein extremer DpH
für diesen Effekt verantwortlich, während die stärker supprimierten
Linien Photoinhibition zeigten. Weiterhin trat in den
„antisense“-Linien eine bis zu 25%ige Reduktion im Chlorophyllgehalt
bei erhöhten Chlorophyll a/b-Verhältnissen auf. Eine solche
Akklimatisierung tritt bei Pflanzen auf, die an schwache
Lichtintensitäten adaptiert sind und Starklicht ausgesetzt werden.
Eine Überexpression des heterologen fed 1-cDNA-Klon aus Spinat in
Kartoffelpflanzen hatte gegenteilige Effekte zur Folge. Die
Elektronentransportketten zwischen den Photosystemen waren weniger
reduziert, die Transformanten wiesen in Kurzzeitversuchen eine bis zu
10% höhere CO2-Assimilation auf und auch die Effizienz der
Lichtnutzung war erhöht. Die im Vergleich zu Wildtyp-Pflanzen stark
erhöhten Chlorophyllfluoreszenz-Endsignale deuten darauf hin, daß ein
größerer Anteil stromaler Akzeptoren reduziert vorliegt. Gleichzeitig
war das Chlorophyll a/b-Verhältnis erniedrigt. In Abhängigkeit von der
Fd I-Menge, und im Endeffekt vermutlich durch die im Stroma verfügbare
Akzeptor-Menge bedingt, erfolgt eine Erhöhung bzw. Erniedrigung von
qP. Der permanent erhöhte Redoxstatus zwischen den Photosystemen
scheint in den Fd I-Transformanten eine Adaptation des Chlorophyll
a/b-Verhältnisses in die Richtung zu bewirken, daß im Fall der
Unterexprimierer eine Anpassung in Richtung Starklicht erfolgt,
während die Überexprimierer eine Schwachlichtanpassung zeigen. Ein
Hinweis in diese Richtung ist die gute Korrelation zwischen qP und dem
Chlorophyll a/b-Verhältnis.
Isolierung von ftr a- und ftr b-cDNA-Klonen aus Kartoffel und
Herstellung transgener Kartoffel-pflanzen
Für eine Manipulation der Elektronenflüsse in Richtung Td erfolgte
eine „antisense“-Transfor-mation mit dem ftr b-cDNA-Klon aus
Kartoffelblatt (diese Arbeit). Die primären Transformanten wiesen
keinen Phänotyp auf. Eine Transformation im heterologen System mit dem
„antisense“-ftr b-cDNA-Klon aus Spinat erwies sich als ineffektiv.
Eine Überexpression des ftr b-cDNA-Klons aus Spinat in Kartoffel war
erfolgreich; Pflanzen mit Cosuppression wurden nicht gefunden. Auch
erfolgte in diesen Pflanzen keine Coregulation in der Expression der
FTR A-Untereineinheit. Für eine Überexpression von funktioneller FTR
könnte der ftr a-cDNA-Klon aus Kartoffelblatt (diese Arbeit) zusammen
mit dem ftr b-cDNA-Klon transformiert werden.
6 Literatur
Allen JF, Bennett J, Steinback KE, Arntzen CJ (1981): Chloroplast
protein phosphorylation couples plastoquinone redox state to
distribution of excitation energy between photosystems. Nature 291,
25-29
Allen JF (1992): Protein phosphorylation in regulation of
photosynthesis. Biochim Biophys Acta 1098, 275-335
Allen JF (1993a): Control of gene expression by redox potential and
the requirement for chloroplast and mitochondrial genomes. J Theor
Biol 165, 609-631
Allen JF (1993b): Redox control of transcription: sensors, response
regulators, activators and repressors. FEBS Lett 332, 203-207
Allen JF (1993c): Redox control of gene expression and the function of
chloroplast genomes - an hypothe­sis. Photosynth Res 36, 95-102
Allen JF, Nilsson A (1997): Redox signalling and the structural basis
of regulation of photosynthesis by protein phosphorylation. Physiol
Plant 100, 863-868
Altvater-Mackensen R, Strotmann H (1988): Contents of endogenous
adenine nucleotides and ATPase activity of isolated whole
chloroplasts. Biochim Biophys Acta 934, 213-219
Anderson JM, Osmond CB (1987): Shade-sun responses: Compromises
between acclimation and photoin­hibition. In: Photoinhibition, (Kyle,
DJ, Osmond CB, Arntzen CJ, Eds), pp 2-36, Elsevier, Amsterdam
Anderson JM, Price GD, Chow WS, Hope AB, Badger MR (1997): Reduced
levels of cytochrome bf complex in transgenic tobacco leads to marked
photochemical reduction of the plastoquinone pool, with­out
significant change in acclimation to irradiance. Photosynth Res 53,
215-227
Andersson B, Aro EM (1997): Proteolytic activities and proteases of
plant chloroplasts. Physiol Plant 100, 780-793
Aoki K, Wada K (1996): Temporal and spatial distribution of ferredoxin
isoproteins in tomato fruit. Plant Physiol 112, 651-657
Arnon DI (1969): Role of ferredoxin in photosynthesis.
Naturwissenschaften 56, 295‑305
Arnon DI (1988): The discovery of ferredoxins: The photosynthetic
path. Trends Biochem Sci 13, 30-33
Arnon DI, Chain R (1979): Regulatory electron transport pathways in
cyclic photophosphorylation. FEBS Lett 102, 133-138
Asada K, Kiso K, Yoshikawa K (1974): Univalent reduction of molecular
oxygen by spinach chloroplasts on illumination. J Biol Chem 249,
2175-2181
Asada K, Nakano Y (1978): Affinity for oxygen in photoreduction of
molecular oxygen and scavenging of hydrogen peroxide in spinach
chloroplasts. Photochem Photobiol 28, 917-920
Asada K, Takahashi M (1987): Production and scavenging of active
oxygen in photosynthesis. In: Photoinhibition, (Kyle DJ, Osmond CB,
Arntzen CJ, Eds), pp 227‑287, Elsevier, Amsterdam
Asada K, Heber U, Schreiber U (1992): Pool size of electrons that can
be donated to P700+, as deter­mined in intact leaves: Donation to P700+
from stromal components via the intersystem chain. Plant Cell Physiol
33, 927-932
Baalmann E (1993): Untersuchungen zum Aktivierungsmechanismus der
chloroplastidären Glyzerinalde­hyd-3-Phosphat-Dehydrogenase aus
Spinat. Diplomarbeit, Universität Osnabrück
Baalmann E, Backhausen JE, Rak C, Vetter S, Scheibe R (1995):
Reductive modification and nonreduc­tive activation of purified
spinach chloroplast NADP-dependent glyceraldehyde-3-phosphate
dehydrogenase. Arch Biochem Biophys 324, 201-208
Baalmann E, Backhausen JE, Kitzmann C, Scheibe R (1994): Regulation of
NADP-dependent glyceraldehyde 3-phosphate dehydrogenase activity in
spinach chloroplasts. Bot Acta 107, 313-320
Backhausen JE (1994): Die Bedeutung des Malat-Ventils für die
Regulation der Photosynthese. Disserta­tion, Universität Osnabrück
Backhausen JE, Emmerlich A, Holtgrefe S, Horton P, Rogers JJM,
Müller-Röber B, Scheibe R (1998): Transgenic potato plants with
altered expression levels of chloroplast NADP-malate dehydro­genase:
Interactions between photosynthetic electron transport and malate
metabolism in leaves and in isolated intact chloroplasts. Planta 207,
104-114
Backhausen JE, Kitzmann C, Horton P, Scheibe R (2000): Electron
acceptors in isolated intact spinach chloroplasts act hierarchally to
prevent over-reduction and competition for electrons. Photosyn Res 64,
1-13
Backhausen JE, Kitzmann C, Scheibe R (1994): Competition between
electron acceptors in photosynthe­sis: Regulation of the malate valve
during CO2 fixation and nitrite reduction. Photosynth Res 42, 75-86
Backhausen JE, Scheibe R (1999): Adaptation of tobacco plants to
elevated CO2: Influence of age on changes in physiology, redox states
and NADP-malate dehydrogenase activity. J Exp Bot 50, 665-675
Bader KP, Röben A (1995): Mass spectrometric detection and analysis of
nitrogen fixation in Oscillatoria chalybea. Z Naturforsch 50c, 199-204
Bader KP, Schmid GH, Ruyters G, Kowallik W (1992): Blue light enhanced
respiratory activity under photosynthetic conditions in Chlorella; a
mass spectrometric analysis. Z Naturforsch 47c, 881‑888
Badger MR (1985): Photosynthetic oxygen exchange. Ann Rev Plant
Physiol 36, 27‑53
Baena-González E, Barbato R, Aro EM (1999): Role of phosphorylation in
the repair cycle and oli­gomeric structure of photosystem II. Planta
208, 196-204
Baier M, Dietz KJ (1997): The plant 2-Cys peroxiredoxin BAS1 is a
nuclear-encoded chloroplast protein: its expression regulation,
phylogenetic origin, and implications for its specific function in
plants. Plant J 12, 179-190
Ballicora MA, Frueauf JB, Fu Y, Schürmann P, Preiss J (2000):
Activation of the potato tuber ADP-glucose pyrophosphorylase by
thioredoxin. J Biol Chem 275, 1315-1320
Baroli I, Melis A (1998): Photoinhibitory damage is modulated by the
rate of photosynthesis and by the photosystem II light-harvesting
chlorophyll antenna size. Planta 205, 288-296
Baysdorfer C, Robinson JM (1985): Metabolic interactions between
spinach leaf nitrite reductase and ferredoxin-NADP reductase.
Competition for reduced ferredoxin. Plant Physiol 77, 318‑320
Bendall DS, Manasse RS (1995): Cyclic photophosphorylation and
electron transport. Biochim Biophys Acta 1229, 23-38
Berkowitz GA, Peters JS (1993): Chloroplast inner-envelope ATPase acts
as a primary H+ pump. Plant Physiol 102, 261‑267
Birnboim HC, Doly J (1979): A rapid alkaline extraction procedure for
screening recombinant plasmid DNA. Nucl Acids Res 7, 1513-1523
Böhme H (1977): On the role of ferredoxin and ferredoxin-NADP+
reductase in cyclic electron transport of spinach chloroplasts. Eur J
Biochem 72, 283-289
Bovy A, van den Berg C, De Vrieze G, Thompson WF, Weisbeek P, Smeekens
S (1995): Light-regu­lated expression of the Arabidopsis thaliana
ferredoxin gene requires sequences upstream and down­stream of the
transcription initiation site. Plant Mol Biol 27, 27-39
Bradford mM (1976): A rapid and sensitive method for the quantitation
of microgram quantities of pro­tein utilizing the principle of
protein-dye binding. Anal Biochem 72, 248-254
Bringloe DH, Dyer TA, Gray JC (1995): Developement, circadian and
light regulation of wheat ferre­doxin gene expression. Plant Mol Biol
27, 293-306
Brunswick P, Cresswell CF (1988): Nitrite uptake into intact pea
chloroplasts. I. Kinetics and relationship with nitrite assimilation.
Plant Physiol 86, 378-383
Buchanan BB, Arnon DI (1971): Ferredoxins from photosynthetic
bacteria, algae, and higher plants. Methods Enzymol 23, 413‑440
Buchanan BB (1980): Role of light in the regulation of chloroplast
enzymes. Ann Rev Plant Physiol 31, 341‑374
Bullock WO, Fernandez JM, Short JM (1987): XL1-Blue: A high efficiency
plasmid transforming recA Escherichia coli strain with ß-galactosidase
selection. Biotechniques 5, 376-379
Bunik V, Follmann H, Bisswanger H (1997): Activation of mitochondrial
2-oxoacid dehydrogenases by thioredoxin. Biol Chem 378, 1125-1130
Bunik V, Raddatz G, Lemaire S, Meyer Y, Jacquot JP, Bisswanger H
(1999): Interaction of thioredox­ins with target proteins: Role of
particular structural elements and electrostatic properties of
thioredox­ins in their interplay with 2-oxoacid dehydrogenase
complexes. Prot Sci 8: 65-74.
Burrows PA, Sazanov LA, Svab Z, Maliga P, Nixon PJ (1998):
Identification of a functional respiratory complex in chloroplasts
through analysis of tobacco mutants containing disrupted platid ndh
genes. Embo J 17, 868-876
Carlberg I, Andersson B (1996): Phosphatase activities in spinach
thylakoid membranes – Effectors, regu­lation and location. Photosynth
Res 47, 145-156
Carlberg I, Rintamäki E, Aro EM, Andersson B (1999): Thylakoid protein
phosphorylation and the thiol redox state. Biochemistry 38, 3197-3204
Carver KA, Walker DA (1983): The effect of adenylate-kinase activity
in a reconstituted chloroplast sys­tem; determination of ATP, ADP, and
AMP with luciferin-luciferase. Sci Tools 30, 1-5
Casper T, Quail PH(1993): Promotor and leader regions involved in the
expression of the Arabidopsis ferredoxin A gene. Plant J 3, 161-174
Cerff R (1982): Separation and purification of NAD- and NADP-linked
glyceraldehyde-3-phosphate dehy­drogenases from higher plants. In:
Methods in chloroplast molecular biology (Edelmann M, Hallick RB, Chua
NH, eds), pp 683-694, Elsevier Biomedical press, Amsterdam, New York,
Oxford
Charles SA, Halliwell B (1980): Effect of hydrogen peroxide on spinach
(Spinacia oleracea) chloroplast fructose bisphosphatase. Biochem J 189,
373‑376
Chow LP, Iwadate H, Yano K, Kamo M, Tsugita A, Gadet-Salvi L,
Stritt-Etter AL, Schürmann P (1995): Amino acid sequence of spinach
ferredoxin:thioredoxin reductase catalytic subunit and identifi­cation
of thiol groups constituting a redox active disulfide and a [4Fe-4S]
cluster. Eur J Biochem 231, 149-156
Church GM, Gilbert W. (1984): Genomic sequencing. Proc Natl Acad Sci
USA 78, 3595-3599
Cleland RE, Bendall DS (1992): Photosystem I cyclic electron
transport: Measurement of ferredoxin-plastoquinone reductase activity.
Photosynth Res 34, 409-418
Copeland L, Preiss J (1981): Purification of spinach leaf ADP glucose
pyrophosphorylase. Plant Physiol 68, 996‑1001
Cox GB, Denvenish RJ, Gibson F, Howitt SM, Nagley P (1992): The
structure and assembly of ATP synthase. In: Molecular mechanisms in
bioenergetics. (Ernster L, Ed), pp 121-143, Elsevier, Amster­dam
Crawford NA, Droux M, Kosower NS, Buchanan BB (1989): Evidence for
function of the ferre­doxin/thioredoxin system in the reductive
activation of target enzymes of isolated intact chloroplasts. Arch
Biochem Biophys 271, 223-239
Creighton TE (1984): Interactions between cysteine residues as probes
of protein conformation: The disul­fide bond between Cys-14 and Cys-38
of the pancreatic trypsin inhibitor. J Mol Biol 96, 767-776
Cséke C, Buchanan BB (1986): Regulation of the formation and
utilisation of photosynthate in leaves. Biochim Biophys Acta 853,
43-63
Dai S, Schwendtmeyer C, Schürmann P, Ramaswamy S, Eklund H (2000a):
Redox signaling in chloro­plasts: Cleavage of disulfides by an
iron-sulfur cluster. Science 287, 655-658
Dai S, Schwendtmeyer C, Johansson K, Ramaswamy S, Schürmann P, Eklund
H (2000b): How does light regulate chloroplast enzymes?
Structure-function studies of the ferredoxin/thioredoxin system. Quart
Rev Biophys 33, 67-108
Danon A, Mayfield SP (1994): Light-regulated translation of
chloroplast messenger RNAs through redox potential. Science 266,
1717-1719
De Boer AD, Weisbeek PJ (1991): Chloroplast protein topogenesis:
Import, sorting and assembly. Biochim Biophys Acta 1071, 221-253
Debleare R, Bytebier B, De Greve H, Debroek F, Schell J, van Montagu
M, Leemans J (1985): Effi­cient octopine Ti-plasmid derived vectors of
Agrobacterium mediated gene transfer in plants. Nucl Acids Res 13,
4777-4788
Dellaporta SL, Wood J, Hicks JB (1983): A plant DNA minpreparation,
version two. Plant Mol Biol Rep 1, 19-21
Delumeau O, Renard M, Montrichard F (2000): Characterization and
possible redox regulation of the purified calmodulin-dependent NAD+
kinase from Lycopersicon pimpinellifolium. Plant Cell Environ 23,
1267-1273
Demmig-Adams B (1990): Carotenoids and photoprotection in plants: A
role for the xanthophyll zeaxan­thin. Biochim Biophys Acta 1020, 1‑24
Demmig-Adams B, Adams III WW (1992): Photoprotection and other
responses of plants to high light stress. Annu Rev Plant Physiol Plant
Mol Biol 43, 599‑626
Denecke J, Bottermann J, Deblaere L (1990): Protein secretion in plant
cells can occur via a default path­way. Plant Cell 2, 51-59
Dickey LF, Gallo-Meagher M, Thompson WF (1992): Light regulatory
sequences are located within the 5` portion of the fed-1 message
sequence. EMBO J 11, 2311-2317
Dickey LF, Nguyen TT, Allen GC, Thompson WF (1994): Light modulation
of ferredoxin mRNA abun­dance requires an open reading frame. Plant
Cell 6, 1171-1176
Dobres MS, Elliott RC, Watson JC, Thompson WF (1987): A phytochrome
regulated pea transcript en­codes ferredoxin I. Plant Mol Biol 8,
53-59
Droux M, Jacquot JP, Miginiac-Maslow M, Gadal P, Huet JC, Crawford NA,
Yee BC, Buchanan BB (1987a): Ferredoxin-thioredoxin reductase, an
iron-sulfur enzyme linking light to enzyme regulation in oxygenic
photosynthesis: Purification and properties of the enzyme from C3, C4,
and cyanobacterial species. Arch Biochem Biophys 252, 426-439
Droux M, Miginiac-Maslow M, Jacquot JP, Gadal P, Crawford NA, Kosower
NS, Buchanan BB (1987b): Ferredoxin-thioredoxin reductase: A
catalytically active dithiol group links photoreduced ferre­doxin to
thioredoxin functional in photosynthetic enzyme regulation. Arch
Biochem Biophys 256, 372-380
Dunn PP, Gray JC (1988): Nucleotide sequence of the frxB gene in wheat
chloroplast DNA. Nucl Acids Res 16, 348
Durnford DG, Falkowski PG (1997): Chloroplast redox regulation of
nuclear gene transcription during photoacclimation. Photosynth Res 53,
229-241
Dutton JE, Rogers LJ, Haslett BG, Takuru IAH, Gleaves JT, Boulter D
(1980): Comparative studies on the properties of two ferredoxins from
Pisum sativum L. J Exp Bot 31, 379-391
Elich TD, Edelman M, Mattoo AK (1993): Dephosphorylation of
photosystem II core proteins is light regulated in vivo. EMBO J 12,
4857-4862
Elliott RC, Dickey LF, White MJ, Thompson WF (1989): Cis-acting
elements for light regulation of pea ferredoxin 1 gene expression are
located within transcribed sequences. Plant Cell 1, 691-698
Emanuelsson O, Nielsen H, von Heijne G (1999): ChloroP, a neural
network-based method for predicting cloroplast transit peptides and
their cleavage sites. Protein Sci 8, 978-984
Escoubas JM, Lomas M, LaRoche J, Falkowski PG (1995): Light intensity
regulation of cab gene tran­scription is signaled by the redox state
of the plastoquinone pool. Proc Natl Acad Sci USA 92, 10237-10241
Falkenstein E, von Schaewen A, Scheibe R (1994): Full-length cDNA
sequences for both ferredoxin-thio­redoxin reductase subunits from
spinach (Spinacia oleracea L.). Biochim Biophys Acta 1185, 252-254
Falkenstein E (1995): Untersuchungen zur Lokalisierung des
Redoxmodulationssystems in Chloroplasten von Spinat und
molekularbiologische Charakterisierung des zentralen Enzyms
Ferredoxin/Thioredoxin-Reduktase. Dissertation, Universität Osnabrück
Faske M (1992): Reinigung und Charakterisierung des
Chloroplasten-Enzyms Phosphoribulokinase aus Spinat (Spinacia oleracea)
und Versuche zum Thiol/Disulfid-Redoxpotential des gereinigten Enzyms.
Diplomarbeit, Universität Osnabrück
Faske M, Holtgrefe S, Ocheretina O, Meister M, Backhausen JE, Scheibe
R (1994): Redox equilibria between the regulatory thiols of
light/dark-modulated enzymes and dithiothreitol: Fine-tuning by
me­tabolites. Biochim Biophys Acta 1247: 135-142
Faske M, Backhausen JE, Sendker M, Singer-Bayerle M, Scheibe R, von
Schaewen A (1997): Trans­ge­nic tobacco plants expressing a
heterologous pea chloroplast Nmdh cDNA in sense and antisense
ori­en­tation: Effect on NADP-malate dehydrogenase level, stability of
transformants and plant growth. Plant Physiol 115, 705-717
Feild TS, Nedbal L, Ort DR (1998): Nonphotochemical reduction of the
plastoquinone pool in sun­flower leaves originates from
chlororespiration. Plant Physiol 116: 1209-1218
Feinberg AP, Vogelstein B (1983): A technique for radiolabelling DNA
restriction endonuclease frag­ments to high specific activity. Anal
Biochem 132, 6-13 und (1984): Abbendum 137: 266-267
Ferté N, Meunier JC, Sauve P, Ricard J (1984): Control of
chloroplastic NADP-malate dehydrogenase activity by thioredoxins.
Plant Sci Lett 35, 175‑179
Fischer N, Hippler M, Setif P, Jacquot JP, Rochaix JD (1998): The PsaC
subunit of photosystem I pro­vides an essential lysine residue for
fast electron transfer to ferredoxin. EMBO J. 16, 849-858.
Fliege R, Flügge UI, Werdan K, Heldt HW (1978): Specific transport of
inorganic phosphate, 3-phosphoglycerate and triosephosphates across
the inner membrane of the envelope in spinach chloro­plasts. Biochim
Biophys Acta 502, 232‑247
Flinta C, Persson B, Jörnvall H, von Heijne G (1986): Sequence
determinants of cytosolic N-terminal protein processing. Eur J Biochem
154, 193-196
Flügge UI, Freisl M, Heldt HW (1980): Balance between metabolite
accumulation and transport in rela­tion to photosynthesis by isolated
chloroplasts. Plant Physiol 65, 574‑577
Fork DC, Herbert SK (1993): Electron transport and
photophosphorylation by photosystem I in vivo in plants and
cyanobacteria. Photosynth Res 36, 149-168
Foyer CH, Halliwell B (1976): The presence of glutathione and
glutathione reductase in chloroplasts: A proposed role in ascorbic
acid metabolism. Planta 133, 21-25
Foyer C, Rowell J, Walker D (1983): Measurements of the ascorbate
content of spinach leaf protoplasts and chloroplasts during
illumination. Planta 157, 239‑244
Foyer CH, Furbank RT, Walker DA (1989): Coregulation of electron
transport and Benson-Calvin cycle activity in isolated spinach
chloroplasts: Studies on glycerate 3-phosphate reduction. Arch Biochem
Biophys 268, 678-697
Foyer C, Furbank R, Harbinson J, Horton P (1990): The mechanisms
contributing to photosynthetic control of electron transport by carbon
assimilation in leaves. Photosynth Res 25, 83‑100
Foyer CH, Lelandais M, Harbinson J (1992): Control of the quantum
efficiencies of photosystem I and II, electron flow, and enzyme
activation following dark-to-light transitions in pea leaves.
Relationship be­tween NADP/NADPH ratios and NADP-malate dehydrogenase
activation state. Plant Physiol 99, 979‑986
Foyer CH, Lescure JC, Lefebvre C, Morot-Gaudry JF, Vincentz M,
Vaucheret H (1994): Adaptaions of photosynthetic electron transport,
carbon assimilation, and carbon partioning in transgenic Nicotiana
plumbaginifolia plants to changes in nitrite reductase activity. Plant
Physiol 104, 171-178
Fridlyand LE, Backhausen JE, Holtgrefe S; Kitzmann C, Scheibe R
(1997): Quantitative evaluation of the 3-phosphoglycerate reduction
rate in chloroplasts. Plant Cell Physiol 38, 1177-1186
Fridlyand LE, Backhausen JE, Scheibe R (1998): Flux control of the
malate valve in leaf cells. Arch Biochem Biophys 349, 290-298
Fromm H, Devic M, Fuhr R, Edelman M (1985): Control of psbA gene
expression: in mature Spirodela chloroplasts light regulation of 32-kd
protein synthesis is independent of transcription level. EMBO J 4,
291-295
Fu Y, Ballicora MA, Leykam JF, Preiss J (1998): Mechanism of reductive
activation of potato tuber ADP-glucose pyrophosphorylase. J Biol Chem
273, 25045-25052
Fujita Y, Murakami A, Ohki K (1987): Regulation of photosystem
composition in the cyanobacterial photosynthetic system: the
regulation occurs in response to the redox state of the electron
-“pools“ lo­cated between the two photosystems Plant Cell Physiol 28,
283-292
Furbank RT, Badger MR, Osmond CB (1982): Photosynthetic oxygen
exchange in isolated cells and chloroplasts of C3 plants. Plant
Physiol 70, 927‑931
Furbank RT, Badger MR (1983): Oxygen exchange associated with electron
transport and photophos­phorylation in spinach thylakoids. Biochim
Biophys Acta 723, 400-409
Furbank RT, Horton P (1987): Regulation of photosynthesis in isolated
barley protoplasts: The contribu­tion of cyclic photophosphorylation.
Biochim. Biophys. Acta 894, 332‑338
Gal A, Zer H, Ohad I (1997): Redox-controlled thylakoid
phosphorylation. News and views. Physiol Plant 100, 869-885
Gallo-Meagher M, Sowinski DA, Elliott RC, Thompson WF (1992): Both
internal and external regula­tory elements control expression of the
pea Fed-1 gene in transgenic tobacco seedlings. Plant Cell 4, 389-395
Gardemann A, Stitt M, Heldt HW (1983): Control of CO2 fixation.
Regulation of spinach ribulose-5-phosphate kinase by stromal
metabolite levels. Biochim Biophys Acta 722, 51‑60
Gardemann A (1983): Untersuchungen zur Regulation der
chloroplastidären Ribulose-5-Phosphat Kinase und
Fructose-1,6-bisphosphatase. Dissertation, Universität Göttingen
Gardemann A, Schimkat D, Heldt HW (1986): Control of CO2 fixation.
Regulation of stromal fructose-1,6-bisphosphatase in spinach by pH and
Mg2+ concentration. Planta 168, 536-545
Gardeström P (1996): Interactions between mitochondria and
chloroplasts. Biochim Biophys Acta 1275, 38-40
Gavel Y, von Heijne G (1990): A conserved cleavage-site motif in
chloroplast transit peptides. FEBS Lett 261, 455-458
Genty B, Briantais JM, Baker NR (1989): The relationship between the
quantum yield of photosynthetic electron transport and quenching of
chlorophyll fluorescence. Biochim Biophys Acta 990, 87‑92
Gerst U, Schönknecht G, Heber U (1994): ATP and NADPH as the driving
force of carbon reduction in leaves in relation to thylakoid
energization by light. Planta 193, 421‑429
Giersch C, Heber U, Kobayashi Y, Inoue Y, Shibata K, Heldt HW (1980):
Energy charge, phosphoryla­tion potential and proton motive force in
chloroplasts. Biochim Biophys Acta 590, 59‑73
Gilbert HF (1984): Redox control on enzyme activities by
thiol/disulfide exchange. Methods Enzymol 107: 330-351
Golbeck JH (1992): The structure of photosystem I. Curr Opin Struct
Biol 3, 508-514
Graeve K, von Schaewen A, Scheibe R (1994): Purification,
characterization, and cDNA sequence of glucose-6-phosphate
dehydrogenase from potato (Solanum tuberosum L.). Plant J 5, 353-361
Gray GR, Ivanov AG, Krol M, Huner NPA (1998): Adjustment of thylakoid
plastoquinone content and photosystem I electron donor pool size in
response to growth temperature and growth irradiance in winter rye (Secale
cereale L.) Photosynth Res 56, 209-221
Green LS, Yee BC, Buchanan BB, Kamide K, Sanada Y, Wada K (1991):
Ferredoxin and ferredoxin-NADP reductase from photosynthetic and
nonphotoynthetic tissues of tomato. Plant Physiol 96, 1207-1213
Groden D, Beck E (1979): H2O2 destruction by ascorbate-dependent
systems from chloroplasts. Biochim Biophys Acta 546, 426-435
Grossmann A, Bartlett S, Chua NH (1980): Engery dependent uptake of
cytoplasmatically synthesized polypeptides by chloroplasts. Nature 285,
625-628
Hanahan D (1983): Studies on transformation of Escherichia coli with
plasmids. J Mol Biol 166, 557‑580
Harbinson J, Foyer HC (1991): Relationships between the efficiencies
of photosystems I and II and stro­mal redox state in CO2-free air.
Plant Physiol 97, 41‑49
Harbinson J, Genty B, Baker NR (1989): Relationship between the
quantum efficiencies of photosystem I and II in pea leaves. Plant
Physiol 90, 1029‑1034
Harrison MA, Allen JF (1991): Light-dependent phosphorylation of
photosystem II polypeptides main­tains electron transport at high
light intensity: Separation from effects of phosphorylation of LHC-II.
Biochim Biophys Acta 1058, 289-296
Hase T, Kimata Y, Yonekura K, Matsumara T, Sakakibara H (1991):
Molecular cloning and differen­tial expression of the maize ferredoxin
gene family. Plant Physiol 96, 77-83
Hatch MD, Dröscher L, Flügge UI, Heldt HW (1984): A specific
translocator for oxaloacetate transport in chloroplasts. FEBS Lett 178,
15‑19
Hayashida N, Matsubayashi T, Shinozaki K, Sugiura M, Inoue K, Hiyama T
(1987): The gene for the 9 kd polypeptide, a possible apoprotein for
the iron-sulfur centers A and B of the photosystem I com­plex, in
tobacco chloroplast DNA. Curr Genet 12, 247-250
Heber U, Kirk MR (1975): Flexibility of coupling and stoichiometry of
ATP formation in intact chloro­plasts. Biochim Biophys Acta 376,
136‑150
Heber U, Walker D (1992): Concerning a dual function of coupled cyclic
electron transport in leaves. Plant Physiol 100, 1621‑1626
Heimann S, Schreiber U (1999): Cyt b-559 (Fd) participating in cyclic
electron transport in spinach chloroplasts: Evidence for kinetic
connection with the Cyt b6/f complex. Plant Cell Physiol 40, 818-824
Heineke D, Riens B, Grosse H, Hoferichter P, Peter U, Flügge UI, Heldt
HW (1991): Redox transfer across the inner chloroplast envelope
membrane. Plant Physiol 95, 1131‑1137
Heldt HW, Werdan K, Milovancey M, Geller G (1973): Alkalization of the
chloroplast stroma caused by light-dependent proton flux into the
thylakoid space. Biochim Biophys Acta. 314, 224‑241
Heldt HW (1979): Light-dependent changes of stromal H+ and Mg2+
concentrations controlling CO2 fixa­tion. In: Encyclopedia of Plant
Physiology 6 (Gibbs M, Latzko E, Eds), pp 202-207, Springer-Verlag,
Berlin
Heldt HW, Flügge UI (1987): Subcellular transport in plant cells.
Biochem Plants 12, 49-85
Heldt HW, Flügge UI (1992): Metabolite transport in plant cells. In:
Society for Experimental Biology Seminar Series, Vol. 50: Plant
organelles, (Tobin, AK, Ed), pp 21‑47, University Press, Cambridge
Hirasawa M, Boyer JM, Gray KA, Davis DJ, Knaff DB (1987): The
interaction of ferredoxin-linked sulfite reductase with ferredoxin.
FEBS Lett 221, 343‑348
Hobbs SLA, Kpodar P, DeLong CMO (1990): The effect of T-DNA copy
number, position and methyla­tion on reporter gene expression in
tabacco transformants. Plant Mol Biol 15, 851-864
Hobe S, Förster R, Klinger J, Paulsen H (1995): N-proximal sequence
motif in light-harvesting chloro­phyll a/b-binding protein is
essential for the trimerization of light-harvesting chlorophyll a/b
complex. Biochemistry 34, 10224-10228
Höfgen R, Willmitzer L (1988): Storage of kompetent cells for
Agrobacterium transformation. Nucl Acids Res 16: 9877
Höfte H, Faye L, Dickinson C, Herman EM, Chrispeels MJ (1991): The
protein body proteins phytohe­maglutinin and tonoplast intrinsic
protein are targeted to vacuoles in leaves of transgenic tobacco.
Planta 184: 431-437
HØj PB, Svendsen I, Scheller HV, Moller BL (1987): Identification of a
chloroplast-encoded 9-kDa poly­peptide as a 2[4Fe-4S] protein carrying
centers A and B of photosystem I. J Biol Chem 262, 12676-12684
Holtgrefe S (1993): Reinigung der plastidären
Fructose-1,6-bisphosphatase aus Spinat und Gerste und Un­tersuchungen
zum Redoxverhalten des gereinigten Enzyms. Diplomarbeit, Universität
Osnabrück
Holtgrefe S, Backhausen JE, Kitzmann C; Scheibe R (1997): Regulation
of steady-state photosynthesis in isolated intact chloroplasts under
constant light: Respnses of carbon fluxes, metabolite pool and
enzyme-activation states to changes of the electron pressure. Plant
Cell Physiol 38, 1207-1216
Hope AB, Rich PR (1989): Proton uptake by the chloroplast cytochrome
bf complex. Biochim Biophys Acta 975, 96‑103
Hope AB (1993): The chloroplast cytochrome bf complex: A critical
focus on function. Biochim Biophys Acta 1143, 1-22
Horton P, Ruban AV (1992): Regulation of photosystem II. Photosyn Res
34, 375-385
Horton P, Ruban AV, Walters RG (1996): Regulation of light harvesting
in green plants. Annu Rev Plant Physiol Plant Mol Biol 47, 655-684
Hosler JP, Yocum CF (1987): Regulation of cyclic photophosphorylation
during ferredoxin-mediated electron transport. Effect of DCMU and the
NADPH/NADP+ ratio. Plant Physiol 83, 965‑969
Huang X, Miller W (1991): A time-efficient, linear-space local
similarity algorithm. Adv Apl Math 12, 337-357
Huber JL, Huber SC, Campbell WH Redinbaugh MG (1992): Reversible
light/dark modulation of spin­ach leaf nitrate reductase activity
involves protein phosphorylation. Arch Biochem Biophys 296, 58‑65
Huisman JG, Moormann AFM, Verkley FN (1978): In vitro synthesis of
chloroplast ferredoxin as a high molecular weight precursor in a
cell-free protein synthesizing system from wheat germ. Biochem
Bio­phys Res Comm 82, 1121-1131
Huner NPA, Maxwell DP, Gray GR, Savitch LV, Krol M, Ivanov AG, Falk S
(1996): Sensing envi­romental temperature change through imbalances
between energy supply and energy consumption – redox state of
photosystem II. Physiol Plant 98, 358-364
Hunter SC, Ohlrogge JB (1998): Regulation of spinach chloroplast
acetyl-CoA carboxylase. Arch Biochem Biophys 359, 170-178
Ikeuchi M, Takio K, Inoue Y (1989): N-terminal sequencing of
photosystem II low-molecular-mass pro­teins. 5 and 4.1 kDa components
of the O2-evolving core complex from higher plants. FEBS Lett 242,
263-269
Ivanov B, Kobayashi Y, Bukhov NG, Heber U (1998): Photosystem
I-dependent cyclic electron flow in spinach chloroplasts: Occurrence,
dependence on redox conditions and electron acceptors and inhibi­tion
by antimycin A. Photosynth Res 57, 61-70
Iwadate H, Yano K, Aso K, Kamo M, Schürmann P, Tsugita A (1992):
Structure of spinach ferredoxin-thioredoxin reductase. Photosynth Res
34, 155
Iwadate H, Yano K, Kamo M, Gardet-Salvi L, Schürmann P, Tsugita A
(1994): Amino acid sequence of the spinach ferredoxin:thioredoxin
reductase variable subunit. Eur J Biochem 223, 465-471
Iwadate H, Tsugita A, Chow LP, Kizuki K, Stritt-Etter AL, Li J,
Schürmann P (1996): Amino acid sequence of the maize
ferredoxin:thioredoxin reductase variable subunit. Eur J Biochem 241,
121-125
John I, Hackett R, Cooper W, Drake R, Farrell A, Gierson D (1997):
Cloning and characterization of tomato leaf senescence-related cDNAs.
Plant Mol Biol 33, 641-651
Junge W (1989): Protons, the thylakoid membrane, and the chloroplast
ATP synthase. Ann N Y Acad Sci 574, 268‑286
Kaiser WM (1976): The effect of hydrogen peroxide on CO2 fixition of
isolated intact chloroplasts. Biochim Biophys Acta 440, 476-482
Kaiser WM (1979): Reversible inhibition of the calvin cycle and
activation of oxidative pentose phosphate cycle in isolated intact
chloroplasts by hydrogen peroxide. Planta 145, 377-382
Kaiser WM, Spill D, Brendle-Behnisch E (1992): Adenine Nucleotides are
involved in the light-dark modulation of spinach nitrate reductase.
Planta 186, 236-40
Kamide K, Sakai H, Aoki K, Sanada Y, Wada K, Green LS, Yee BC,
Buchanan BB (1995): Amino acid sequences of heterotrophic and
photosynthetic ferredoxins from the tomato plant (Lycopersicon
escu­lentum Mill.). Photosynth Res 46, 301-308
Kaneko T, Tanaka A, Sato S, Kotani H, Sazuka T, Miyajima N, Sugiura M,
Tabata S (1995): Sequence analysis of the genome of the unicellular
cyanobacterium Synechocystis sp. strain PCC6803. I. Sequence features
in the 1 Mb region from map positions 64% to 92% of the genome. J DNA
Res 2, 153-166
Karpinski S, Escobar C, Karpinska B, Creissen G, Mullineaux PM (1997):
Photosynthetic electron transport regulates the expression of
cytosolic ascorbate peroxidase genes in Arabidopsis during light
stress. Plant Cell 9, 627-640
Karpinski S, Reynolds H, Karpinska B, Wingsle G, Creissen G,
Mullineaux P (1999): Systematic sig­naling and acclimation in response
to excess excitation energy in Arabidopsis. Science 284, 654-657
Katona E, Neimanis S, Schönknecht G, Heber U (1992): Photosystem
I-dependent cyclic electron trans­port is important in controlling
photosystem II activity in leaves under conditions of water stress.
Photosynth Res 34, 449‑464
Kaufman LS, Roberts LL, Briggs WR, Thompson WF (1986): Phytochrome
control of specific mRNA levels in developing pea buds: kinetics of
accumulation, reciprocity and escape kinetics of the low fluence
response. Plant Physiol 81, 1033-1038
Keegstra K (1989): Transport and routing of proteins into
chloroplasts. Cell 56, 247-253
Kim J, Mayfield SP (1997): Protein disulphide isomerase as a regulator
of chloroplast translational activa­tion. Science 278, 1954-1957
Kimata Y, Hase T (1989): Localization of ferredoxin isoproteins in
mesophyll and bundle sheath cells in maize leaf. Plant Physiol 89,
1193-1197
Kimata-Ariga Y, Matsumura T, Kada S, Fujimoto H, Fujita Y, Endo T,
Mano J, Sato T, Hase T (2000): Differential electron floe around
photosystem I by two C4-photsynthetic-cell-specific ferredoxins. EMBO
J 19, 5041-5050
Kitzmann C (1996): Regulatorische Wechselwirkung zwischen
Pyridinnukleotid- und Adenylat-Pool in intakten isolierten
Spinatchloroplasten. Dissertation, Humboldt-Universität, Berlin
Klughammer C, Schreiber U (1994): An improved method, using saturating
light pulses, for the determi­nation of photosystem I quantum yield
via P700+-absorbance changes at 830 nm. Planta 192, 261‑268
Knaff DB (1991): Regulatory phosphorylation of chloroplast antenna
proteins. Trends Biochem Sci 16, 82‑83
Knaff DB, Hirasawa M (1991): Ferredoxin-dependent chloroplast enzymes.
Biochim Biophys Acta 1056, 93-125
Kozak M (1989): The scanning model for translation: An update. J Cell
Biol 108: 229-241
Kramer DM, Wise RR, Frederick JR, Alm DM, Hesketh JD, Ort DR, Crofts
AR (1990): Regulation of coupling factor in field-grown sunflower: A
redox model relating coupling factor activity to the activities of
other thioredoxin-dependent chloroplast enzymes. Photosynth Res 26,
213‑222
Krause GH, Behrend U (1986): pH-dependent chlorophyll fluorescence
quenching indicating a mechanism of protection against photoinhibition
of chloroplasts. FEBS Lett 200, 298‑302
Krauß N, Hinrichs W, Witt I, Fromme P, Pritzkow W, Dauter Z, Betzel C,
Wilson KS, Witt HT, Saenger W (1993): Three-dimensional structure of
system I of photosynthesis at 6 Å resolution. Nature 361, 326-331
Krauß N, Schubert WD, Klukas O, Fromme P, Witt HT, Saenger W (1996):
Photosystem I at 4 Å resolution represents the first structural model
of a joint photosynthetic reaction centre and core antenna system.
Nature Struct Biol 3, 965-973.
Krieger A, Weis E (1993): The role of calcium in the pH-dependent
control of photosystem II. Photo­synth. Res. 37, 117-130
Krieger A, Weis E, Demeter S (1993): Low-pH-induced Ca2+ ion release
in the water-splitting system is accompanied by a shift in the
midpoint redox potential of the primary quinone acceptor QA. Biochim
Biophys Acta 1144, 411‑418
Krömer S, Malmberg G, Gardeström P (1993): Mitochondrial contribution
to photosynthetic metabo­lism. A study with barley (Hordeum vulgare
L.) leaf protoplasts at different light intensities and CO2
concen­trations. Plant Physiol 102, 947-955
Kubicki A, Funk E, Westhoff P, Steinmuller K (1996): Differential
expression of plastome-encoded ndh genes in mesophyll and
bundle-sheath chloroplasts of the C4 plant Sorghum bicolor indicates
that com­plex I-homologous NAD(P)H-plastoquinone oxidoreductase is
involved in cyclic electron transport. Planta 199, 276-281
Laemmli UK (1970): Cleavage of structural proteins during assembly of
the head of bacteriophage T4. Nature 227, 680-685
Laing WA, Stitt M, Heldt HW (1981): Control of CO2 fixation: Changes
in the activity of ribulose phos­phate kinase and fructose- and
seduheptulose-bisphosphatase in chloroplasts. Biochim Biophys Acta 637,
348-359
Lance C, Rustin P (1984): The central role of malate in plant
metabolism. Physiol Veget 22, 625-641
LaRoche J, Mortain-Bertrand A, Falkowski PG (1991): Light
intensity-induced changes in cab mRNA and light harvesting complex II
apoprotein levels in the unicellular chlorophyte Dunaliella
tertiolata. Plant Physiol 97, 147-153
Layzell DB (1990): N2 fixation, NO3- reduction and NH4+ assimilation.
In: Plant Physiology, Biochemistry and Molecular Biology, (Dennis DT
und Turpin DH, Eds), pp 389-406, Longman Scientific & Technical, New
York
Leegood RC (1996): Primary photosynthate production: Physiology and
metabolism. Photoassimilate dis­tribution in plants and crops.
Source-sink relationships. (Zamski E, Schaffer AA, Eds.), pp 21-41,
Marcel Dekker, Inc, New York
Lelong C, Setif P, Lagoutte B, Bottin H (1994): Identification of the
amino acid involved in the functional interaction between photosystem
I and ferredoxin from Synechocystis sp. PCC 6803 by chemical
cross-linking. J Biol Chem 269, 10034-10039
Lendzian K, Bassham JA (1975): Regulation of
glucose-6-phosphate-dehydrogenase in spinach chloro­plasts by ribulose
1,5-diphosphate and NADPH/NADP+ ratios. Biochim Biophys Acta 396,
260-275
Levings III CS, Siedow JN (1995): Regulation by redox poise in
chloroplasts. Science 268, 695-696
Lilley R McC, Fitzgerald MP, Rienits KG, Walker DA (1975): Criteria of
intactness and the photosyn­thetic activity of spinach chloroplast
preparations. New Phytol 75, 1‑10
Lindahl M, Yang DH, Andersson B (1995): Regulatory proteolysis of the
major light-harvesting chloro­phyll a/b protein of photosystem II by
light-induced membrane-associated enzymic system. Eur J Biochem 231,
503-509
Link G (2000): Redox regulation of photosynthetic genes: Regulatory
aspects of photosynthesis (Andersson B, Aro EM, Eds), Chapter 7, pp
1-23, Kluwer Academic Publishers, The Netherlands
Logemann J, Schell J, Willmitzer L (1987): Improved method for the
isolation of RNA from plant tissue. Anal Biochem 163, 16-20
Losada M, Paneque A (1974): Nitrite reductase. Methods Enzymol 23,
487-491
Lütcke HA, Chow KC, Mickel FS, Moss KA, Kern HF, Scheele GA (1987):
Selection of AUG initia­tion codons differs in plants and animals.
EMBO J 6, 43-48
MacKinney G (1941): Absorption of light by chlorophyll solutions. J
Biol Chem 140, 315-322
Marc-Martin S, Spielmann A, Stutz, A, Schürmann P (1993): Cloning and
sequencing of a corn (Zea mays) nuclear gene for the chloroplast
specific catalytic subunit of ferredoxin-thioredoxin reductase.
Biochim Biophys Acta 1183, 207-209.
Marder JB, Barber J (1989): The molecular anatomy and function of
thylakoid proteins. Plant Cell Environ 12, 595‑614
Marsho TV, Behrens PW, Radmer RJ (1979): Photosynthetic oxygen
reduction in isolated intact chloro­plasts and cells from spinach.
Plant Physiol 64, 656‑659
Martinoia E, Rentsch D (1994): Malate compartmentation-responses to a
complex metabolism. Annu Rev Plant Physiol Plant Mol Biol 45, 447-467
Mehler HA (1951): Studies on reactions of illuminated chloroplasts. I.
Mechanism of the reduction of oxy­gen and other Hill reagents. Arch
Biochem Biophys 3, 65-77
Melis A (1999): Photosystem-II damage and repair cycle in
chloroplasts: what modulates the rate of photo­damage in vivo? Trends
Plant Sci 4, 130-135
Mitchell P (1966): Chemiosmotic coupling in oxydative and
photosynthetic phosphorylation. Biol Rev 41, 445‑502
Miyake C, Asada K (1994): Ferredoxin-dependent photoreduction of the
monodehydroascorbate radical in spinach thylakoids. Plant Cell Physiol
35, 539‑549
Morigasaki S, Takada K, Sanada Y Wada K, Yee BC, Shin S, Buchanan BB
(1990): Novel forms of ferredoxin and ferredoxin-NADP+ reductase from
spinach roots. Arch Biochem Biophys 283, 75-80
Moss DA, Bendall DS (1984): Cyclic electron transport in chloroplasts.
The Q-cycle and the site of action of antimycin. Biochim Biophys Acta
767, 389‑395
Murashige T, Skoog F (1962): A revised medium for rapid growth and
biomass with tobacco cultures. Physiol Plant 99, 8-15
Nagy F, Kay SA, Chua NH (1988): A circadian clock regulates
transcription of the wheat cab-1 gene. Genes Devel 2, 376-382
Nasse B (1993): Untersuchungen zur Nitritaufnahme in metabolisch
kompetente Erbsenchloroplasten, Diplomarbeit, Universität Göttingen
Naver H, Scott MP, Golbeck JH, Olsen CE, Scheller HV (1996): The
eight-amino acid loop of PSI-C mediates association of low molecular
mass iron-sulfur proteins with the P700-FX core in photosys­tem I. J
Biol Chem 273, 18778-18783
Nellen W, Lichtenstein C (1993): What makes a mRNA anti-sense-itive?
Trends Biochem Sci 18: 419-423
Neuhaus HE, Stitt M (1989): Pertubation of photosynthesis in spinach
leaf discs by low concentrations of methyl viologen. Influence of
increased thylakoid energisation on ATP synthesis, electron transport,
en­ergy dissipation, light-activation of the Calvin-cycle enzymes, and
control of starch and sucrose synthe­sis. Planta 179, 51‑60
Neuhaus HE, Quick WP, Siegl G, Stitt M (1990): Control of
photosynthate partitioning in spinach leaves. Analysis of the
interaction between feedforward and feedback regulation. Planta 181,
583‑592
Obata S, Nishimura M, Nagai K, Sakihama N, Shin M (1995): Four
ferredoxins from japanese radish leaves. Arch Biochem Biophys 316,
797-802
Ort DR, Melandri BA (1982): Mechanism of ATP synthesis. In: Cell
Biology. Photosynthesis: Energy conversion by plants and bacteria,
Vol. I, (Govindjee, Ed), pp 537‑587. Academic Press, New York
Ort DR (2001): When there is too much light. Plant Physiol 125, 29-32
Osmond CB, Grace SC (1995): Perspectives on photoinhibition and
photorespiration in the field: quintes­sential inefficiencies of the
light and dark reactions of photosynthesis? J Exp Bot 46, 1351-1362
Oxborough K, Horton P (1987): Characterization of the effects of
antimycin A upon high energy state quenching of chlorophyll
fluorescence (qE) in spinach and pea chloroplasts. Photosynth Res 12,
119‑128
Palmgren G, Mattson O, Okkels FT (1993): Treatment of Agrobacterium or
leaf disks with 5-azacytidine increases transgene expression in
tobacco. Plant Mol Biol 21, 429-435
Pandini V, Aliverti A, Zanetti G (1999): Interaction of the soluble
recombinant PsaD subunit of spinach photosystem I with ferredoxin I.
Biochemistry 38, 10707-10713
Paul MJ, Knight JS, Habash D, Parry MAJ, Lawlor DW, Barnes SA, Loynes
A, Gray JC (1995): Re­duction in phosphoribulokinase activity by
antisense RNA in transgenic tobacco: effect on CO2 assimi­lation and
growth in low irradiance. Plant J 7, 535-542
Polle A (1996): Mehler reaction: Friend or Foe in Photosynthesis. Bot
Acta 109, 84-89
Porra RJ, Thompson WA, Kriedemann PE (1989): Determination of the
accurate extinction coefficients and simultaneous equations for
assaying chlorophylls a and b extracted with four different solvents.
Biochim Biophys Acta 975, 384-394
Porter MA (1990): The aggregation states of spinach
phosphoribulokinase. Planta 181, 349‑357
Porter MA, Stringer CD, Hartman FC (1988): Characterization of the
regulatory thioredoxin site of phosphoribulokinase. J Biol Chem 263,
123‑129
Portis AR, McCarty RE (1976): Quantitative relationships between
phosphorylation, electron flow, and internal hydrogen ion
concentrations in spinach chloroplasts. J Biol Chem 251, 1610-1616
Portis AR, Chon C J, Mosbach A, Heldt HW (1977): Fructose-and
Sedoheptulosebisphosphatase. The sites of a possible control of CO2
fixation by light-dependent changes of the stromal Mg2+
concentra­tion. Biochim Biophys Acta 461, 313-325
Price GD, Yu JW, von Caemmerer S, Evans JR, Chow WS, Anderson JM,
Hurry V, Badger MR (1995A): Chloroplast cytochrome b6/f and ATP
synthase complexes in tobacco: Transformation with antisense RNA
against nuclear-encoded transcripts for the Rieske FeS and ATP
polypeptides. Aust J Plant Physiol 22, 285-297
Price GD, Evans JR, von Caemmerer S, Yu JW, Badger MR (1995B):
Specific reduction of chloroplast glyceraldehyde-3-phosphate
dehydrogenase activity by antisense RNA reduces CO2 assimilation via a
reduction in ribulose bisphosphate regeneration in transgenic tobacco.
Planta 195, 369-378
Purczeld P, Chon CJ, Portis Jr AR, Heldt HW, Heber U (1978): The
mechanism of the control of car­bon fixation by the pH in the
chloroplast stroma. Studies with nitrite-mediated proton transfer
across the en­velope. Biochim Biophys Acta 501, 488‑498
Quick WP, Schurr U, Scheibe R, Schulze ED, Rodermel SR, Bogorad L,
Stitt M (1991): Decreased ribulose-1,5-bisphosphate
carboxylase-oxygenase in transgenic tobacco transformed with antisense
rbcS. Planta 183, 542-554
Racker E (1957): The reductive pentose phosphate cycle. I.
Phosphoribulokinase and ribulose diphosphate carboxylase. Arch Biochem
Biophys 69, 300‑310
Raeber L, Gaymard E, Schürmann P (1998): Cloning and sequencing of a
full-length cDNA coding for the precursor of the catalytic subunit of
ferredoxin:thioredoxin reductase (Accession No. Y15076) from soybean.
Plant Gene Register PGR98-010. Plant Physiol 116, 446
Rensink WA, Schnell DJ, Weisbeek PJ (2000): The transit sequence of
ferredoxin contains different do­mains for translocation across the
outer and inner envelope membrane of the chloroplast envelope. J Biol
Chem 275, 10265-10271
Rich PR (1984): Electron and proton transfers through quinones and
cytochrome bf complexes. Biochim Biophys Acta 768, 53-79
Richter S, Lamppa GK (1998): A chlorplast processing enzyme functions
as the general stromal process­ing peptidase. Proc Natl Acad Sci USA
95, 7463-7468
Riens B, Heldt HW (1992): Decrease of nitrate reductase activity in
spinach leaves during a light-dark transition. Plant Physiol 98,
573‑577
Rintamäki E, Salonen M, Suoranta UM, Carlberg I, Andersson B, Aro EM
(1997): Phosphorylation of light-harvesting complex II and photosystem
II core proteins shows different irradiance-dependent regulation in
vivo. J Biol Chem 272, 30476-30482
Rintamäki E, Martinsuo P, Pursiheimo S, Aro EM (2000): Cooperative
regulation of light-harvesting complex II phosphorylation via the
plastoquinol and ferredoxin-thioredoxin system in chloroplasts. Proc
Natl Acad Sci USA 97, 11644-11649
Robinson SP, Walker DA (1979): The control of 3-phosphoglycerate
reduction in isolated chloroplasts by the concentrations of ATP, ADP
and 3-phosphoglycerate. Biochim Biophys Acta 545, 528-536
Robinson HH, Yocum CF (1980): Cyclic photophosphorylation reactions
catalyzed by ferredoxin, methyl viologen and anthraquinone sulfonate.
Biochim Biophys Acta 590, 97-106
Robinson JM, Gibbs M (1982): Hydrogen peroxide synthesis in isolated
spinach chloroplast lamellae. Plant Physiol 70, 1249-1254
Robinson JM (1986): Carbon dioxide and nitrite photoassimilatory
processes do not intercompete for re­ducing equivalents in spinach and
soybean leaf chloroplasts. Plant Physiol 80, 676‑684
Robinson JM (1988): Does O2-photoreduction occur within chloroplasts
in vivo? Physiol Plant 72, 666-680
Robinson JM (1988a): Spinach leaf chloroplast CO2 and NO2
photoassimilations do not compete for photo­generated reductant.
Manipulation of reductant levels by quantum flux density titrations.
Plant Physiol 88, 1373‑1380
Robinson JM (1988b): Does O2-photoreduction occur within chloroplasts
in vivo? Physiol Plant 72, 666‑680
Rousseau F, Sétif P, Lagoutte B (1993): Evidence for the involvement
of PSI-E subunit in the reduction of ferredoxin by photosystem I. EMBO
J 12, 1755-1765
Ruban AV, Young AJ, Pascal AA, Horton P (1994): The effect of
illumination on the xanthophyll com­position of the photosystem II
light-harvesting complexes of spinach thylakoid membranes. Plant
Physiol 104, 227‑234
Rurainski HJ, Borchert S, Heupel R (1987): Ferredoxin-dependent cyclic
electron transport and photo­phosphorylation. In: Progress in
Photosynthesis Research, Vol. III, (Biggins J, Ed), pp 537‑540,
Martinus Publishers, Dordrecht
Rutherford AW (1989): Photosystem II, the water splitting enzyme.
Trends Biochem Sci 14, 227‑232
Sambrook J, Fritsch EF, Maniatis T (1989): Molecular Cloning: A
Laboratory Manual, 2. Ausg.; Cold Spring Harbour Laboratory Press.
Cold Spring Harbour, New York
Sanchez J, Heldt HW (1990): On the regulation of spinach nitrate
reductase. Plant Physiol 92, 684-689
Sanger F, Fritsch EF, Coulson AR (1977): DNA sequencing with
chain-terminating inhibitors. Proc Natl Acad Sc. USA 74, 5463-5467
Sasaki Y, Kozaki A, Hatano M (1997): Link between light and fatty acid
synthesis: thioredoxin-linked reductive activation of plastidic
acetyl-CoA carboxylase. Proc Natl Acad Sci U S A. 94, 11096-101
Savitch LV, Maxwell DP, Huner NPA (1996): Photosystem II excitation
pressure and photosynthetic carbon metabolism in Chlorella vulgaris.
Plant Physiol 111, 127-136
Schäfer C, Schmid V (1993): Pflanzen im Lichtstreß. Überleben durch
biochemische Schutz- und Repara­turmechanismen. BiuZ 23, pp 55-62.
Verlagsgesellschaft mbH, Weinheim
Scheibe R; Jacquot JP (1983): NADP regulates the light activation of
NADP-dependent malate dehydro­genase. Planta 157, 548‑553
Scheibe R (1987): NADP+-malate dehydrogenase in C3-plants: Regulation
and role of a light-activated enzyme. Physiol Plant 71, 393‑400
Scheibe R, Stitt M (1988): Comparison of NADP-malate dehydrogenase
activation, QA reduction and O2 evolution in spinach leaves. Plant
Physiol Biochem 26, 473‑481
Scheibe R (1990): Light-dark Modulation: Regulation of chloroplast
metabolism in a new light. Bot Acta 103, 327-334
Scheibe R (1991): Redox-modulation of chloroplast enzymes. Plant
Physiol 96, 1‑3
Scheller HV (1996): In vitro cyclic electron transport in barley
thylakoids follows two independent path­ways. Plant Physiol 110,
187-194
Schleiff E, Soll J (2000): Travelling of proteins through membranes:
translocation into chloroplasts. Planta 211, 449-456
Schomburg D, Salzmann M, Stephan D (1994): Enzyme handbook.
Ferredoxin-nitrite reductase. Vol 7, Springer-Verlag, Berlin
Schreck R, Rieber P, Baeuerle PA (1991): Reactive oxygen intermediates
as apparently widely used mes­sengers in the activation of the NF-B
transcription factor and HIV-1. EMBO J 10, 2247-2258
Schreiber U, Schliwa U, Bilger W (1986): Continuous recording of
photochemical and non-photochemi­cal chlorophyll fluorescence
quenching with a new type of modulation fluorometer. Photosynth Res 10,
51‑62
Schreiber U, Bilger W, Neubauer C (1994): Chlorophyll fluorescence as
a noninstrusive indicator for rapide assessment of in vivo
photosynthesis. In: Ecophysiology of Photosynthesis, (Schulze ED,
Caldwell MM, Eds), pp 49‑70, Springer-Verlag, Berlin
Schubert WD, Klukas O, Krauß N, Saenger W, Fromme P, Witt HT (1997):
Photosystem I of Synecho­coccus elongatus at 4 Å resolution:
comprehensive structure analysis. J Mol Biol 272, 741-769
Sharkey TD, Stitt M, Heineke D, Gerhardt R, Raschke K, Heldt HW
(1986): Limitation of photosyn­the­sis by carbon metabolism. III. O2-insensitive
CO2 uptake results from limitation of triose phosphate utili­zation.
Plant Physiol 81, 1123-1129
Sharma J, Panico M, Shipton CA, Nilsson F, Morris HR, Barber J (1997):
Primary structure characteri­zation of the photosystem II D1 and D2
subunits. J Biol Chem 272, 33158-33166
Shin M (1974): Ferredoxin-NADP reductase from spinach. Methods
Enzymol. 23, 440-447
Siebke K, Laisk A, Neimanis S, Heber U (1991): Regulation of
chloroplast metabolism in leaves: Evi­dence that NADP-dependent
glyceraldehydephosphate dehydrogenase, but not ferredoxin-NADP
reduc­tase, controls electron flow to phosphoglycerate in the
light-dark transition. Planta 185, 337-343
Sigalat C, Pitard B, Haraux F (1995): Proton coupling is preserved in
membrane-bound chloroplast ATPase activated by high-concentrations of
tentoxin. FEBS Lett 368, 253-256
Smeekens S, van Binsbergen J, Weisbeek P (1985): The plant ferredoxin
precursor: nucleotide sequence of a full length cDNA clone. Nucl Acids
Res 13, 3179-3194
Smeekens S, van Steeg H, Bauerle C, Bettenbroek H, Keegstra K,
Weisbeek P (1987): Import into chloroplasts of a yeast mitrochondrial
protein directed by ferredoxin and plastocyanin transit peptids. Plant
Mol Biol 9, 377-388
Somers DE, Caspar T, Quail PH (1990) : Isolation and characterization
of a ferredoxin gene from Arabi­dopsis thaliana. Plant Physiol 93,
572-577
Soulie JM, Buc J, Riviere M, Ricard J (1985): Equilibrium binding of
thioredoxin fB to chloroplastic fructose bisphosphatase: Evidence for
a thioredoxin site distinct from the active site. Eur J Biochem 152,
565-568
Steiger HM, Beck E (1981): Formation of hydrogen peroxide and oxygen
dependence of photosynthetic CO2 assimilation by intact chloroplasts.
Plant Cell Physiol 22, 561‑576
Stitt M (1986): Limitation of photosynthesis by carbon metabolism. 1.
Evidence for excess electron trans­port capacity in leaves carrying
out photosynthesis in saturating light and CO2. Plant Physiol 81,
1115‑1122
Strotmann H, Bickel-Sandkötter S (1984): Structure, function, and
regulation of chloroplast ATPase. Annu Rev Plant Physiol 35, 97-120
Suzuki A, Oaks A, Jacquot JP, Vidal J, Gadal P (1985): An electron
transport system in maize roots for reactions of glutamate synthase
and nitrite reductase. Plant Physiol 78, 374-378
Szekeres M, Droux M, Buchanan BB (1991): The ferredoxin-thioredoxin
reductase variable subunit gene from Anacystis nidulans. J Bacteriol
173, 1821-1823.
Takahama U, Shimizu-Takahama M, Heber U (1981): The redox state of the
NADP system in illumi­nated chloroplasts. Biochim Biophys Acta 637,
530‑539
Takahashi Y, Hase T, Wada K, Matsubara H (1983): Ferredoxin in
developing spinach cotyledons: The presence of two molecular species.
Plant Cell Physiol 24, 189-198
Takahashi Y, Mitsui A, Hase T, Matsubara H (1986): Formation of the
iron-sulfur cluster of ferredoxin isolated chloroplasts. Proc Natl
Acad Sci, USA 83,2434-2437
Terashima I, Inoue Y (1985): Palisade tissue chloroplasts and spongy
tissue chloroplasts in spinach: Bio­chemical and ultrastructural
differences. Plant Cell Physiol 26, 63-75
Terashima I, Funayama S, Sonoike K (1994): The site of photoinhibition
in leaves of Cucumis sativus L. at low temperatures in photosystem I,
not photosystem II. Planta 193: 300-306
Trebst A (1994): Dynamics in photosystem II structure and function.
In: Ecophysiology of Photosynthesis, (Schulze ED, Caldwell MM, Eds),
pp 3‑15, Springer Verlag, Berlin
Tsugita A, Yano K, Gardet-Salvi L, Schürmann P (1991):
Characterization of spinach ferredoxin-thiore­doxin reductase. Protein
Seq Data Anal 4, 9-13
Tullberg A, Alexciev K, Pfannschmidt T, Allen JF (2000):
Photosynthetic electron flow regulates tran­scription of the psaB gene
in pea (Pisum sativum L.) chloroplasts through the redox state of the
plas­toquinone pools. Plant Cell Physiol 41, 1045-1054
Turpin DH, Weger HG (1990): Interactions between photosynthesis,
respiration and nitrogen assimila­tion. In: Plant Physiology,
Biochemistry and Molecular Biology, (Dennis DT, Turpin DH, Eds), pp
423-433, Longman Scientific & Technical, New York
van Camp W, van Montagu M, Inzé D (1998): H2O2 and NO: redox signals
in disease resistance. Trends Plant Sci 3, 330-334
van Kooten O, Snell J (1990): The use of chlorophyll fluorescence
nomenclature in plant stress physiology. Photosynth Res 25, 147-50
Vega JM, Cárdenas J, Losada M (1980): Ferredoxin-nitrite reductase.
Methods Enzymol 69, 255‑270
Vener AV, Ohad I, Andersson B (1998): Protein phosphorylation and
redox sensing in chloroplast thyla­koids. Curr Opinion Plant Biol 1,
217-223
Vervliet G, Holsters M, Teuchy H, van Montagu M, Schell J (1975):
Characterization of different plaque-forming and defective temperate
phages in Agrobacterium strains. J Gen Virol 26: 33-48
von Heijne G, Stepphuhn J, Herrmann RG (1989): Domain structure of
mitochondrial and chloroplast targeting peptides. Eur J Biochem 180,
535-545
von Heijne G (1992): Sequence determinants for protein import into
chloroplasts and thylakoid membrane protein assembly. In: Transport
and Receptor proteins of plant membranes (Cooke DT, Clarkson DT, eds),
pp 145-165, Plenum Press, NY, USA
von Schaewen A, Langenkämper G, Graeve K, Wenderoth I, Scheibe R
(1995): Molecular characteri­zation of the plastidic
glucose-6-phosphate dehydrogenase from potato in comparison to its
cytosolic counterpart. Plant Physiol 109, 1327-1335
Vorst O, van Dam F, Oosterhoff-Teerstra R, Smeekens S, Weisbeek P
(1990): Tissue-specific expres­sion directed by an Arabidopsis
thaliana pre-ferredoxin promotor in transgenic tobacco plants. Plant
Mol Biol 14, 491-499
Wada K, Onda M, Matsubara H (1989): Amino acid sequences of ferredoxin
isoproteins from raddish roots. J Biochem 105, 619-625
Walker D (1987): The use of the oxygen electrode and fluorescence
probes in simple measurements of photosynthesis. Oxygraphics Limited,
Sheffield
Walters RG, Horton P (1994): Acclimation of Arabidopsis thaliana to
the light environment: Changes in composition of the photosynthetic
apparatus. Planta 195, 248-256
Waterhouse PM, Graham MW, Wang MB (1998): Virus resistance and gene
silencing in plants can be induced by simultaneous expression of sense
and antisense RNA. Proc Natl Acad Sci USA 95, 13959-13964
Webber AN, Packman LC, Gray JC (1989): A 10 kDa polypeptide associated
with the oxygen-evolving complex of photosystem II has a putative
C-terminal non-cleavable thylakoid transfer domain. FEBS Lett 242,
435-438
Weber K, Osborn M (1969): The reliability of molecular weight
determination by dodecyl sulfate-poly­acrylamide gel electrophoresis.
J Biol Chem 244, 4406-4412
Wedel N, Bartling D, Herrmann RG (1988): Analysis of cDNA clones
encoding for the entire ferre­doxin I precursor polypeptide from
spinach. Bot Acta 101, 295-300
Werdan K, Heldt HW, Milovancev M (1975): The role of pH in the
regulation of carbon fixation in the chloroplast stroma. Studies on CO2
fixation in the light and in the dark. Biochem Biophys Acta 396,
276-292
Wirtz W, Stitt M, Heldt HW (1982): Light activation of calvin cycle
enzymes as measured in pea leaves. FEBS Lett 142, 223-226
Wolosiuk RA, Perelmuter ME, Chehebar C (1980): Enhancement of
chloroplast fructose-1,6-bisphos­phatase activity by
fructose-1,6-biphosphate and dithiotreitol reduced thioredoxin-f. FEBS
Lett 109, 289-293
Woo KC (1983): Evidence for cyclic photophosphorylation during 14CO2
fixation in intact chloroplasts. Plant Physiol 72, 313‑320
Wu W, Berkowitz GA (1992): Stromal pH and photosynthesis are affected
by electroneutral K+ and H+ exchange through chloroplast envelope ion
channels. Plant Physiol 98, 666‑672
Wünschiers R, Heide H, Follmann H, Senger H, Schulz R (1999): Redox
control of hydrogenase activ­ity in the green alga Scenedesmus
obliquus by thioredoxin and other thiols. FEBS Lett. 455, 162-164
Yang DH, Webster J, Adam Z, Lindahl M, Andersson B (1998): Induction
of acclimative proteolysis of light-harvesting chlorophyll a/b protein
of photosystem II in response to elevated light intensities. Plant
Physiol 118, 827-834
Zanetti G, Merati G (1987): Interaction between photosystem I and
ferredoxin. Identification by chemical cross-linking of the
polypeptide which binds ferredoxin. Eur J Biochem 169, 143-146
Zer H, Ohad I (1995): Photoinactivation of photosystem-II induces
changes in the photochemical reaction center II abolishing the
regulatory role of the QE site in the D1 protein degradation. Eur J
Biochem 231, 448-453
Zer H, Vink M, Keren N, Dilly-Hartwig HG, Paulsen H, Herrmann RG,
Andersson B, Ohad I (1999): Regulation of thylakoid protein
phosphorylation at the substrate level: Reversible light-induced
confor­mational changes expose the phosphorylation site of the
light-harvesting complex II. Proc Natl Acad Sci USA 96, 8277-8282
Zhang N, Portis AR Jr (1999): Mechanism of light regulation of
rubisco: A specific role for the larger rubisco activase isoform
involving reductive activation by thioredoxin-f. Proc Natl Acad Sci
USA 96, 9438-9443
Zimmermann G, Kelly G, Latzko E (1976): Efficient purification and
molecular properties of spinach fructose-1,6-bisphosphatase. Eur J
Biochem 70, 361-367
7 Anhang
Abkürzungen
1,3bisPGA
1,3-bis-Phosphoglycerat
3PGA
3-Phosphoglycerat
A
Absorption
ADP
Adenosindiphosphat
Amp
Ampicillin
APS
Ammoniumperoxidisulfat
ATP
Adenosintriphosphat
BAP
bakterielle alkalische Phosphatase
bp
Basenpaar(e)
bidest.
doppelt destilliertes Wasser
BSA
Rinder (bovine)-serumalbumin
bzw.
beziehungsweise
CaMV
Cauliflower Mosaik Virus
cDNA
copy-DNA
Chl
Chlorophyll
Ci
Curie
Cla
Claforan
Cyt
Cytochrom
DEPC
Diethylpyrocarbonat
DHAP
Dihydroxyacetonphosphat
DIG
Digoxigenin
DMF
N,N-Dimethylformamid
DMSO
Dimethylsulfoxid
DNA
Desoxyribonukleinsäure (nucleic acid)
pH
transmembraner Protonengradient
DTT
DL-Dithiothreitol
E
Extinktion
EDTA
Ethylendiamintetraessigsäure
Em
Redoxpotential (midpoint potential)
I
Quantenausbeute von PS I
II
Quantenausbeute von PS II
F6P
Fructose-6-Phosphat
FBP
Fructose-1,6-bisphosphat
FBPase
Fructose-1,6-bisphosphatase
Fd
Ferredoxin(e)
FM
maximale variable Fluoreszens
FNR
Ferredoxin-NADP-Reduktase
FO
Chlorophyllfluoreszens im Grundzustand
FTR
Ferredoxin-Thioredoxin-Reduktase
Fv
variable Chlorophyllfluoreszenz
Fv(S)
variable Fluoreszenz zum Zeitpunkt des Sättigungspulses
g
Erdbeschleunigung
GA3
Gibberellinsäure
GAP
Glycerinaldehyd-3-Phosphat
GAPDH
Glycerinaldehyd-3-Phosphat-Dehydrogenase
GDH
Glycerin-3-Phosphat-Dehydrogenase
GSH
reduziertes Glutathion
GSSG
oxidiertes Glutathion
G1P
Glucose-1-Phosphat
G6P
Glucose-6-Phosphat
G6PDH
Glucose-6-Phosphat-Dehydrogenase
HEPES
4-(-2-Hydroxyethyl)-1-piperazinethansulfonsäure
IPTG
Isopropyl-ß-d-Thiogalaktopyranosid
Ka
Aktivierungs-Konstante
Kan
Kanamycin
kb
Kilobase(n)
kDa
Kilodalton
Km
Michaelis-Menten-Konstante
LDH
Lactat-Dehydrogenase
LHC
Lichtsammelkomplex (light harvesting complex)
MDA
Monodehydroascorbat-Radikal
MDH
Malat-Dehydrogenase
MES
2-(N-Morpholino)ethansulfonsäure
mRNA
Boten- (messenger) RNA
MW
Molekulargewicht
n
Anzahl der Messungen
NAA
Naphtylessigsäure
NAD(H)
(reduziertes) Nicotinamidadenosinsdinukleotid
NADP(H)
(reduziertes) Nicotinamidadenindinukleotid
NR
Nitratreduktase
NIR
Nitritreduktase
OAA
Oxalacetat
ox
oxidiert
P680
Chlorophyll a-Dimer im Reaktionszentrum von PS II
P700
Chlorophyll a-Dimer im Reaktionszentrum von PS I
PAGE
Polyacrylamid-Gelelektrophorese
PAM
Pulsamplitudenmoduliertes Chlorophyllfluoreszenzdetektionssystem
PCR
Polymerase-Kettenreaktion (chain reaction)
PEP
Phosphoenolpyruvat
PGI
Phosphoglycerat-Isomerase
PGK
Phosphoglycerat-Kinase
pH
negativer dekadischer Logarithmus der Wasserstoffionenkonzentration
Pi
anorganisches Phosphat
PMSF
Phenylmethylsulfonylfluorid
PQ
Plastochinon
PRI
Phosphoriboisomerase
PRK
Phosphoribulokinase
PS
Photosystem
PVPP
Polyvinylpolypyrrolidone
QA
primärer Chinonakzeptor von PS II
QB
sekundärer Chinonakzeptor von PS II
QN, qNP
nicht-photochemische Löschung der variablen Chlorophyllfluoreszenz
qP
photochemische Löschung der variablen Chlorophyllfluoreszenz
r
Resistenzgen
red
reduziert
Rib5P
Ribose-5-Phosphat
Rif
Rifampicin
RNA
Ribonukleinsäure (nucleic acid)
RNase A
Ribonuklease A
RNasin
Inhibitor für Ribonuklease
RubisCO
Ribulose-1,5-bisPhosphat-Carboxylase/Oxigenase
RuBP
Ribulose-1,5-bisPhosphat
Ru5P
Ribulose-5-Phosphat
SBPase
Seduheptulose-1,7-bisphosphatase
SD
Standardabweichung
SDS
Natrium (sodium)-dodecylsulfat
SOD
Superoxid-Dismutase
SP
sättigender Lichtpuls
Spec
Spectinomycin
Strep
Streptomycin
TBE
Tris gepuffertes (buffered) EDTA
TBS
Tris gepufferte Salzlösung (buffered saline)
TBST
TBS-Tween
Td
Thioredoxin(e)
TE
Tris-EDTA
TEMED
N,N,N’,N’-Tetramethylethylendiamin
tet
Tetrazyklin
TPI
Triosephosphat-Isomerase
Tris
Tris-Hydroxymethylaminomethan
U
Unit(s) (= µmol Substratumsatz · min-1)
üN
über Nacht
v
Volumen (volume)
VA
Maximalaktivität
var.
Varietät (variety)
w
weight
WT
Wildtyp
Aminosäurecode
A
Ala
Alanin
C
Cys
Cystein
D
Asp
Asparaginsäure
E
Glu
Glutaminsäure
F
Phe
Phenylalanin
G
Gly
Glycin
H
His
Histidin
I
Ile
Isoleucin
K
Lys
Lysin
L
Leu
Leucin
M
Met
Methionin
N
Asn
Asparagin
P
Pro
Prolin
Q
Gln
Glutamin
R
Arg
Arginin
S
Ser
Serin
T
Thr
Threonin
V
Val
Valin
W
Try
Tryptophan
Y
Tyr
Tyrosin
Basen
A
Adenin
C
Cytosin
G
Guanin
T
Tymin
U
Uracil
Lebenslauf
Persönliche Daten
Name: Simone Holtgrefe
Geburtsdatum: 25.06.64 in Ostercappeln
Kind: Tochter Nadine, geb. 22.11.80
Eltern: Marianne und Karl-Heinz Holtgrefe,
49179 Ostercappeln
Schule
1970 - 1974 Grundschule Ludwig-Windthorst-Schule, Ostercappeln
1974 - 1984 Gymnasium Carolinum, Osnabrück
Abschluß: Abitur
Berufstätigkeit
06.84 - 10.86 Angestellte bei der Wollgroßhandlung Reller,
Ostercappeln
10.86 - 07.93 Studium der Biologie an der Universität Osnabrück,
Abschluß: Diplom, in der Pflanzenphysiologie bei Prof. Dr. R. Scheibe
Thema der Diplomarbeit: „Reinigung der plastidären
Fructose-1,6-bisphosphatase aus Spinat und Gerste und Untersuchungen
zum Redox­verhalten des gereinigten Enzyms“
08.93 – 12.98 Mitarbeit am Institut für Pflanzenphysiologie an der
Universität Osna­brück; Praktische Arbeiten zur Dissertation wurden
bis 08.97 abge­schlossen.
Wissenschaftliche Tätigkeit
02.99 - 01.01 Wissenschaftliche Angestellte in der Nephrologie am
Klinikum Mann­heim, Universität Heidelberg; Bearbeitung eines von der
Deutschen Forschungsgemeinschaft geförderten Projektes mit dem Thema:
„Dia­betische Nephropathie und Heparansulfat-Proteoglykane“
05.01 - dato Wissenschaftliche Angestellte am Institut für
Pflanzenphysiologie an der Universität Osnabrück
Danksagung
An dieser Stelle möchte ich besonders Frau Prof. Dr. R. Scheibe für
die Überlassung des inte­res­santen Themas sowie die intensive
Betreuung und die zahlreichen anregenden Diskussionen dan­ken. Auch
danke ich ihr für die finanzielle Unterstützung während des gesamten
Zeitrau­mes mei­ner Mitarbeit in ihrer Arbeitsgruppe.
Mein herzlicher Dank gilt Jan Backhausen für die Betreuung und
Anleitung in sämtlichen phy­siologischen Fragestellungen. Weiterhin
möchte ich ihm nicht nur für die vielen Anregungen und kritischen
Diskussionen danken, die maßgeblich für die erfolgreiche Entwicklung
der Thematik waren, sondern auch für die freundschaftliche
Unterstützung und die schöne gemein­sam ver­brachte Zeit.
In diesem Zusammenhang möchte ich mich bei Dr. Camillo Kitzmann für
die erfolgreiche Zu­sammenarbeit in der „Chloroplasten-Physiologie“
bedanken.
Besonders danke ich Dr. Antje von Schaewen (Universität Münster) für
die Betreuung des molekularbiologischen Teils dieser Arbeit und ihre
stetige und fruchtbare Auseinandersetzung mit dem Thema.
Für die gute Zusammenarbeit und die vielen Anregungen zur Bewertung
der Fluoreszenzdaten danke ich Prof. P. Horton (Robert-Hill-Institut,
University of Sheffield).
Dr. K. P. Bader (Universität Bielefeld) danke ich für die
Hilfestellungen bei den massenspekt­ro­skopischen Messungen.
Für die zur Verfügungstellung des Fd I-Klons aus Spinat danke ich Dr.
N. Wedel (ehemals Universität Osnabrück).
Dr. E. Falkenstein (ehemals Universität Osnabrück) möchte ich für die
Überlassung des FTR A-Klons aus Spinat und die anti-FTR-Antikörper
danken und A. Tegeler (ehemals Uni­versität Osnabrück) danke für die
Bereitstellung der anti-Fd I-Antikörper aus Spinat.
K. Jäger, A. Lohstroh, H. Wolf-Wibbelmann danke ich für die
professionelle Pflanzenanzucht.
Ein ganz besonderer Dank sei an Maria Faske gerichtet, die mich zu
jeder Zeit und in jeglicher Hinsicht voll unterstützt hat. Für die
gute Zusammenarbeit im Labor, viele wertvolle Rat­schläge und nicht
zuletzt das jederzeit freundschaftliche Arbeitsklima möchte ich mich
bei Elisabeth Baalmann, Susanne Vetter, Irina Wenderoth, Oksana
Ocheretina, Rüdiger Hauschild und Ulrike Nick herzlich bedanken.
Allen weiteren Mitgliedern der Arbeitsgruppe Pflanzenphysiologie danke
ich für ihre Koope­rati­vität und das kameradschaftliche Verhältnis.
Meiner Tochter Nadine bin ich zu besonderem Dank verpflichtet, da sie
sehr viel Verständnis aufgebracht hat und mir immer neue Motivation
gab. Ein herzliches Dankeschön für den er­haltenen Rückhalt an meine
Familie und meine Freunde.
Eidesstattliche Versicherung
Hiermit erkläre ich, daß ich die vorliegende Arbeit selbstständig
verfaßt und keine anderen als die von mir angegebenen Hilfsmittel
verwendet habe.
Ferner erkläre ich, daß ich weder an der Universität Osnabrück noch
anderweitig versucht habe, eine Dissertaion einzureichen oder mich
einer Doktorprüfung zu unterziehen.
Osnabrück, den 30. März 2002
Simone Holtgrefe